Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/FR47-DUF1778 |
Location | 75343..76140 | Replicon | plasmid pEH4236 |
Accession | NZ_CP104404 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain csa13R |
Toxin (Protein)
Gene name | KacT | Uniprot ID | F5S3R9 |
Locus tag | N5F14_RS23885 | Protein ID | WP_006812498.1 |
Coordinates | 75343..75867 (-) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | F5S3R8 |
Locus tag | N5F14_RS23890 | Protein ID | WP_006812497.1 |
Coordinates | 75871..76140 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F14_RS23860 (N5F14_23860) | 73014..73802 | + | 789 | WP_032655902.1 | receptor-recognizing protein | - |
N5F14_RS23865 (N5F14_23865) | 73877..74200 | + | 324 | WP_000064173.1 | hypothetical protein | - |
N5F14_RS23870 (N5F14_23870) | 74214..74906 | + | 693 | WP_006812500.1 | membrane protein | - |
N5F14_RS23875 (N5F14_23875) | 74908..75159 | + | 252 | WP_000147960.1 | hypothetical protein | - |
N5F14_RS23880 (N5F14_23880) | 75152..75316 | + | 165 | WP_006812499.1 | hypothetical protein | - |
N5F14_RS23885 (N5F14_23885) | 75343..75867 | - | 525 | WP_006812498.1 | GNAT family N-acetyltransferase | Toxin |
N5F14_RS23890 (N5F14_23890) | 75871..76140 | - | 270 | WP_006812497.1 | DUF1778 domain-containing protein | Antitoxin |
N5F14_RS23895 (N5F14_23895) | 76522..77187 | + | 666 | WP_023315962.1 | AAA family ATPase | - |
N5F14_RS23900 (N5F14_23900) | 77193..77546 | + | 354 | WP_160859104.1 | hypothetical protein | - |
N5F14_RS23905 (N5F14_23905) | 77588..78385 | - | 798 | WP_006812584.1 | DUF2971 domain-containing protein | - |
N5F14_RS23910 (N5F14_23910) | 78649..79374 | + | 726 | WP_006812583.1 | hypothetical protein | - |
N5F14_RS23915 (N5F14_23915) | 79435..80775 | + | 1341 | WP_006812582.1 | DnaB-like helicase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..110885 | 110885 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19356.13 Da Isoelectric Point: 8.9844
>T257898 WP_006812498.1 NZ_CP104404:c75867-75343 [Enterobacter hormaechei subsp. steigerwaltii]
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0QWY8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0QUA3 |