Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4764734..4765350 | Replicon | chromosome |
| Accession | NZ_CP104403 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain csa13R | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5F14_RS23055 | Protein ID | WP_017382676.1 |
| Coordinates | 4764734..4765105 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | N5F14_RS23060 | Protein ID | WP_015569912.1 |
| Coordinates | 4765108..4765350 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5F14_RS23040 (N5F14_23040) | 4762234..4763136 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| N5F14_RS23045 (N5F14_23045) | 4763133..4763768 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5F14_RS23050 (N5F14_23050) | 4763765..4764694 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| N5F14_RS23055 (N5F14_23055) | 4764734..4765105 | - | 372 | WP_017382676.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5F14_RS23060 (N5F14_23060) | 4765108..4765350 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| N5F14_RS23065 (N5F14_23065) | 4765549..4766469 | + | 921 | WP_133983330.1 | alpha/beta hydrolase | - |
| N5F14_RS23070 (N5F14_23070) | 4766478..4767419 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| N5F14_RS23075 (N5F14_23075) | 4767464..4767901 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| N5F14_RS23080 (N5F14_23080) | 4767898..4768779 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| N5F14_RS23085 (N5F14_23085) | 4768773..4769372 | - | 600 | WP_133983332.1 | glucose-1-phosphatase | - |
| N5F14_RS23090 (N5F14_23090) | 4769491..4770291 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13737.88 Da Isoelectric Point: 6.4882
>T257897 WP_017382676.1 NZ_CP104403:c4765105-4764734 [Enterobacter hormaechei subsp. steigerwaltii]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|