Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3868697..3869354 | Replicon | chromosome |
Accession | NZ_CP104403 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain csa13R |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A179PSF7 |
Locus tag | N5F14_RS18670 | Protein ID | WP_017382887.1 |
Coordinates | 3868697..3869107 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | N5F14_RS18675 | Protein ID | WP_003863437.1 |
Coordinates | 3869088..3869354 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F14_RS18650 (N5F14_18650) | 3864695..3866428 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
N5F14_RS18655 (N5F14_18655) | 3866434..3867147 | - | 714 | WP_033487627.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5F14_RS18660 (N5F14_18660) | 3867176..3868072 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
N5F14_RS18665 (N5F14_18665) | 3868174..3868695 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
N5F14_RS18670 (N5F14_18670) | 3868697..3869107 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
N5F14_RS18675 (N5F14_18675) | 3869088..3869354 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
N5F14_RS18680 (N5F14_18680) | 3869649..3870629 | + | 981 | WP_047636517.1 | tRNA-modifying protein YgfZ | - |
N5F14_RS18685 (N5F14_18685) | 3870741..3871400 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
N5F14_RS18690 (N5F14_18690) | 3871667..3872398 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
N5F14_RS18695 (N5F14_18695) | 3872515..3872976 | + | 462 | Protein_3651 | family 1 glycosylhydrolase | - |
N5F14_RS18700 (N5F14_18700) | 3873031..3873735 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
N5F14_RS18705 (N5F14_18705) | 3873802..3874035 | - | 234 | Protein_3653 | protein-disulfide reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T257896 WP_017382887.1 NZ_CP104403:c3869107-3868697 [Enterobacter hormaechei subsp. steigerwaltii]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A179PSF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |