Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 651983..652559 | Replicon | chromosome |
Accession | NZ_CP104403 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain csa13R |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A800YKM1 |
Locus tag | N5F14_RS03210 | Protein ID | WP_015572580.1 |
Coordinates | 651983..652270 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A801DSF4 |
Locus tag | N5F14_RS03215 | Protein ID | WP_017694570.1 |
Coordinates | 652257..652559 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F14_RS03185 (N5F14_03185) | 647076..647795 | + | 720 | WP_050515874.1 | winged helix-turn-helix domain-containing protein | - |
N5F14_RS03190 (N5F14_03190) | 647945..648415 | + | 471 | WP_033486706.1 | MarR family transcriptional regulator | - |
N5F14_RS03195 (N5F14_03195) | 648412..649479 | + | 1068 | WP_026080654.1 | HlyD family secretion protein | - |
N5F14_RS03200 (N5F14_03200) | 649469..650545 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
N5F14_RS03205 (N5F14_03205) | 650542..651813 | - | 1272 | WP_033486707.1 | DUF445 domain-containing protein | - |
N5F14_RS03210 (N5F14_03210) | 651983..652270 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
N5F14_RS03215 (N5F14_03215) | 652257..652559 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
N5F14_RS03220 (N5F14_03220) | 652588..653226 | - | 639 | WP_033486708.1 | LysE family translocator | - |
N5F14_RS03225 (N5F14_03225) | 653265..654017 | - | 753 | WP_033486709.1 | AraC family transcriptional regulator | - |
N5F14_RS03230 (N5F14_03230) | 654171..655541 | + | 1371 | WP_133982341.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
N5F14_RS03235 (N5F14_03235) | 655723..656268 | - | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T257884 WP_015572580.1 NZ_CP104403:651983-652270 [Enterobacter hormaechei subsp. steigerwaltii]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11482.13 Da Isoelectric Point: 10.4094
>AT257884 WP_017694570.1 NZ_CP104403:652257-652559 [Enterobacter hormaechei subsp. steigerwaltii]
MSIVKHKRGSAPEVSARREAELKALADKPDREIDYSDIPATEDDRWAGAVRGKFYRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLRDQNKK
MSIVKHKRGSAPEVSARREAELKALADKPDREIDYSDIPATEDDRWAGAVRGKFYRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLRDQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|