Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 367638..368249 Replicon chromosome
Accession NZ_CP104403
Organism Enterobacter hormaechei subsp. steigerwaltii strain csa13R

Toxin (Protein)


Gene name hicA Uniprot ID D2TUP9
Locus tag N5F14_RS01835 Protein ID WP_012906750.1
Coordinates 368070..368249 (-) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A6G3F240
Locus tag N5F14_RS01830 Protein ID WP_045339414.1
Coordinates 367638..368048 (-) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5F14_RS01805 (N5F14_01805) 362801..363715 + 915 WP_045911469.1 baseplate J/gp47 family protein -
N5F14_RS01810 (N5F14_01810) 363708..364259 + 552 WP_045899434.1 phage tail protein I -
N5F14_RS01815 (N5F14_01815) 364262..366562 + 2301 WP_045911468.1 phage tail protein -
N5F14_RS01820 (N5F14_01820) 366564..366986 + 423 WP_045340310.1 tail fiber assembly protein -
N5F14_RS01825 (N5F14_01825) 366990..367556 - 567 WP_045911467.1 serine acetyltransferase -
N5F14_RS01830 (N5F14_01830) 367638..368048 - 411 WP_045339414.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N5F14_RS01835 (N5F14_01835) 368070..368249 - 180 WP_012906750.1 type II toxin-antitoxin system HicA family toxin Toxin
N5F14_RS01840 (N5F14_01840) 368455..368721 - 267 WP_126527285.1 hypothetical protein -
N5F14_RS01845 (N5F14_01845) 368705..368950 - 246 WP_045339410.1 DinI-like family protein -
N5F14_RS01850 (N5F14_01850) 369215..369985 + 771 WP_045339416.1 BRO family protein -
N5F14_RS01855 (N5F14_01855) 370179..371273 - 1095 WP_045339409.1 site-specific integrase -
N5F14_RS01860 (N5F14_01860) 371361..372398 + 1038 WP_230016888.1 tRNA dihydrouridine(20/20a) synthase DusA -
N5F14_RS01865 (N5F14_01865) 372535..372777 + 243 WP_017382623.1 envelope stress response protein PspG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 324395..375418 51023


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6644.85 Da        Isoelectric Point: 10.9132

>T257883 WP_012906750.1 NZ_CP104403:c368249-368070 [Enterobacter hormaechei subsp. steigerwaltii]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14890.79 Da        Isoelectric Point: 4.3170

>AT257883 WP_045339414.1 NZ_CP104403:c368048-367638 [Enterobacter hormaechei subsp. steigerwaltii]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDDYQDAIESVREAIEAHIELLVEDGESVPEATTVENWLSDPEYAGAVWALVD
VDITRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6XDK4

Antitoxin

Source ID Structure
AlphaFold DB A0A6G3F240

References