Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3892406..3893063 | Replicon | chromosome |
Accession | NZ_CP104401 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain colR |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A179PSF7 |
Locus tag | N5F15_RS18775 | Protein ID | WP_017382887.1 |
Coordinates | 3892406..3892816 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | N5F15_RS18780 | Protein ID | WP_003863437.1 |
Coordinates | 3892797..3893063 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F15_RS18755 (N5F15_18755) | 3888404..3890137 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
N5F15_RS18760 (N5F15_18760) | 3890143..3890856 | - | 714 | WP_033487627.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5F15_RS18765 (N5F15_18765) | 3890885..3891781 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
N5F15_RS18770 (N5F15_18770) | 3891883..3892404 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
N5F15_RS18775 (N5F15_18775) | 3892406..3892816 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
N5F15_RS18780 (N5F15_18780) | 3892797..3893063 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
N5F15_RS18785 (N5F15_18785) | 3893358..3894338 | + | 981 | WP_047636517.1 | tRNA-modifying protein YgfZ | - |
N5F15_RS18790 (N5F15_18790) | 3894450..3895109 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
N5F15_RS18795 (N5F15_18795) | 3895376..3896107 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
N5F15_RS18800 (N5F15_18800) | 3896224..3896685 | + | 462 | Protein_3672 | family 1 glycosylhydrolase | - |
N5F15_RS18805 (N5F15_18805) | 3896740..3897444 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
N5F15_RS18810 (N5F15_18810) | 3897511..3897744 | - | 234 | Protein_3674 | protein-disulfide reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T257878 WP_017382887.1 NZ_CP104401:c3892816-3892406 [Enterobacter hormaechei subsp. steigerwaltii]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A179PSF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |