Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2393049..2393788 | Replicon | chromosome |
Accession | NZ_CP104401 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain colR |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
Locus tag | N5F15_RS11665 | Protein ID | WP_003857133.1 |
Coordinates | 2393049..2393534 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | N5F15_RS11670 | Protein ID | WP_003857131.1 |
Coordinates | 2393522..2393788 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F15_RS11640 (N5F15_11640) | 2388583..2389167 | - | 585 | WP_017382349.1 | GDP-mannose pyrophosphatase nudK | - |
N5F15_RS11645 (N5F15_11645) | 2389254..2390012 | + | 759 | WP_045341969.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
N5F15_RS11650 (N5F15_11650) | 2390117..2391409 | + | 1293 | WP_133982766.1 | glycosyl hydrolase family 28 protein | - |
N5F15_RS11655 (N5F15_11655) | 2391655..2392413 | + | 759 | WP_230016020.1 | hypothetical protein | - |
N5F15_RS11660 (N5F15_11660) | 2392429..2392998 | + | 570 | WP_017382346.1 | hypothetical protein | - |
N5F15_RS11665 (N5F15_11665) | 2393049..2393534 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
N5F15_RS11670 (N5F15_11670) | 2393522..2393788 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
N5F15_RS11675 (N5F15_11675) | 2393852..2394781 | - | 930 | WP_133982768.1 | LysR family transcriptional regulator | - |
N5F15_RS11680 (N5F15_11680) | 2394911..2396293 | + | 1383 | WP_062938939.1 | MFS transporter | - |
N5F15_RS11685 (N5F15_11685) | 2396316..2397311 | - | 996 | WP_045339807.1 | DUF2891 domain-containing protein | - |
N5F15_RS11690 (N5F15_11690) | 2397321..2398307 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T257870 WP_003857133.1 NZ_CP104401:c2393534-2393049 [Enterobacter hormaechei subsp. steigerwaltii]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L9PBP9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |