Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1146907..1147527 Replicon chromosome
Accession NZ_CP104401
Organism Enterobacter hormaechei subsp. steigerwaltii strain colR

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag N5F15_RS05510 Protein ID WP_015571250.1
Coordinates 1146907..1147125 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag N5F15_RS05515 Protein ID WP_006809850.1
Coordinates 1147153..1147527 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5F15_RS05480 (N5F15_05480) 1142919..1143179 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
N5F15_RS05485 (N5F15_05485) 1143182..1143322 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
N5F15_RS05490 (N5F15_05490) 1143319..1144029 - 711 WP_023303201.1 GNAT family protein -
N5F15_RS05495 (N5F15_05495) 1144131..1145591 + 1461 WP_133982424.1 PLP-dependent aminotransferase family protein -
N5F15_RS05500 (N5F15_05500) 1145563..1146030 - 468 WP_023296041.1 YlaC family protein -
N5F15_RS05505 (N5F15_05505) 1146147..1146698 - 552 WP_015571251.1 maltose O-acetyltransferase -
N5F15_RS05510 (N5F15_05510) 1146907..1147125 - 219 WP_015571250.1 HHA domain-containing protein Toxin
N5F15_RS05515 (N5F15_05515) 1147153..1147527 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
N5F15_RS05520 (N5F15_05520) 1148037..1151183 - 3147 WP_015571248.1 multidrug efflux RND transporter permease subunit AcrB -
N5F15_RS05525 (N5F15_05525) 1151206..1152399 - 1194 WP_047365350.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T257867 WP_015571250.1 NZ_CP104401:c1147125-1146907 [Enterobacter hormaechei subsp. steigerwaltii]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT257867 WP_006809850.1 NZ_CP104401:c1147527-1147153 [Enterobacter hormaechei subsp. steigerwaltii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References