Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 298446..299042 | Replicon | chromosome |
Accession | NZ_CP104401 | ||
Organism | Enterobacter hormaechei subsp. steigerwaltii strain colR |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A837F9W8 |
Locus tag | N5F15_RS01430 | Protein ID | WP_023315213.1 |
Coordinates | 298740..299042 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | N5F15_RS01425 | Protein ID | WP_032672198.1 |
Coordinates | 298446..298733 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5F15_RS01420 (N5F15_01420) | 296818..298449 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
N5F15_RS01425 (N5F15_01425) | 298446..298733 | - | 288 | WP_032672198.1 | putative addiction module antidote protein | Antitoxin |
N5F15_RS01430 (N5F15_01430) | 298740..299042 | - | 303 | WP_023315213.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5F15_RS01435 (N5F15_01435) | 299240..300112 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
N5F15_RS01440 (N5F15_01440) | 300113..300385 | - | 273 | WP_017382612.1 | DUF3811 domain-containing protein | - |
N5F15_RS01445 (N5F15_01445) | 300436..301380 | - | 945 | WP_015570166.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
N5F15_RS01450 (N5F15_01450) | 301474..302823 | - | 1350 | WP_006810501.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11427.21 Da Isoelectric Point: 10.1042
>T257863 WP_023315213.1 NZ_CP104401:c299042-298740 [Enterobacter hormaechei subsp. steigerwaltii]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRVYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10088.51 Da Isoelectric Point: 4.7045
>AT257863 WP_032672198.1 NZ_CP104401:c298733-298446 [Enterobacter hormaechei subsp. steigerwaltii]
MHKLTPYDPANALVDDEEIAVFMADALETGDSAYIAEALGVIARAKGMSTISQQTGLSREQLYRSFSDKGNPTLKTTLAV
MKALGLGLTIKPSGD
MHKLTPYDPANALVDDEEIAVFMADALETGDSAYIAEALGVIARAKGMSTISQQTGLSREQLYRSFSDKGNPTLKTTLAV
MKALGLGLTIKPSGD
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|