Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpB-pemI/PRK09812-MazE |
| Location | 29179..29780 | Replicon | plasmid pHG52 |
| Accession | NZ_CP104394 | ||
| Organism | Enterococcus raffinosus strain HG-5 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | N4S13_RS21520 | Protein ID | WP_244299263.1 |
| Coordinates | 29439..29780 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A4V1ENG6 |
| Locus tag | N4S13_RS21515 | Protein ID | WP_070621550.1 |
| Coordinates | 29179..29439 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4S13_RS21490 (N4S13_21490) | 24422..25462 | + | 1041 | WP_070503196.1 | replication initiator protein A | - |
| N4S13_RS21495 (N4S13_21495) | 25541..26266 | + | 726 | WP_070503194.1 | hypothetical protein | - |
| N4S13_RS21500 (N4S13_21500) | 27390..27731 | + | 342 | WP_070504146.1 | type IV conjugative transfer system protein TraE | - |
| N4S13_RS21505 (N4S13_21505) | 28423..28629 | + | 207 | WP_137438795.1 | hypothetical protein | - |
| N4S13_RS21510 (N4S13_21510) | 28671..28844 | + | 174 | WP_185939400.1 | hypothetical protein | - |
| N4S13_RS21515 (N4S13_21515) | 29179..29439 | + | 261 | WP_070621550.1 | toxin-antitoxin system, antitoxin component, AbrB family protein | Antitoxin |
| N4S13_RS21520 (N4S13_21520) | 29439..29780 | + | 342 | WP_244299263.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| N4S13_RS21525 (N4S13_21525) | 29800..31152 | + | 1353 | WP_070503788.1 | C39 family peptidase | - |
| N4S13_RS21530 (N4S13_21530) | 31176..31901 | + | 726 | WP_070503791.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | erm(B) | - | 1..79977 | 79977 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13110.31 Da Isoelectric Point: 6.8620
>T257861 WP_244299263.1 NZ_CP104394:29439-29780 [Enterococcus raffinosus]
VVEKKIFSDLQQGDILFLDFDPTKGHEQRGYRPCIVLTKSIRFLNYMFGVAPITSNSRSFPLHIPLPETMEVKGNVLLEH
HRMVDLETRTFKFVETAPPEFIEECVAKLKLLY
VVEKKIFSDLQQGDILFLDFDPTKGHEQRGYRPCIVLTKSIRFLNYMFGVAPITSNSRSFPLHIPLPETMEVKGNVLLEH
HRMVDLETRTFKFVETAPPEFIEECVAKLKLLY
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|