Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 787286..787869 | Replicon | plasmid pHG51 |
Accession | NZ_CP104393 | ||
Organism | Enterococcus raffinosus strain HG-5 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R2S2E9 |
Locus tag | N4S13_RS20100 | Protein ID | WP_010743953.1 |
Coordinates | 787525..787869 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R2RFE4 |
Locus tag | N4S13_RS20095 | Protein ID | WP_010743954.1 |
Coordinates | 787286..787531 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4S13_RS20065 (N4S13_20065) | 782507..783811 | + | 1305 | WP_010743959.1 | glycosyltransferase family 2 protein | - |
N4S13_RS20070 (N4S13_20070) | 783938..785023 | + | 1086 | WP_141741229.1 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) | - |
N4S13_RS20075 (N4S13_20075) | 785111..785203 | - | 93 | WP_111945260.1 | type I toxin-antitoxin system Fst family toxin | - |
N4S13_RS20080 (N4S13_20080) | 785285..785902 | - | 618 | WP_010743957.1 | DUF2922 family protein | - |
N4S13_RS20085 (N4S13_20085) | 785948..786332 | - | 385 | Protein_740 | hypothetical protein | - |
N4S13_RS20090 (N4S13_20090) | 786741..786869 | + | 129 | WP_010743955.1 | hypothetical protein | - |
N4S13_RS20095 (N4S13_20095) | 787286..787531 | + | 246 | WP_010743954.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N4S13_RS20100 (N4S13_20100) | 787525..787869 | + | 345 | WP_010743953.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N4S13_RS20105 (N4S13_20105) | 788317..788982 | + | 666 | WP_035015986.1 | helix-turn-helix domain-containing protein | - |
N4S13_RS20110 (N4S13_20110) | 789476..790948 | + | 1473 | WP_010743951.1 | helix-turn-helix domain-containing protein | - |
N4S13_RS20115 (N4S13_20115) | 790965..791744 | + | 780 | WP_010743950.1 | AP2 domain-containing protein | - |
N4S13_RS20120 (N4S13_20120) | 791844..792257 | + | 414 | WP_010743949.1 | Ohr family peroxiredoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | bsh | 1..1028198 | 1028198 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13217.40 Da Isoelectric Point: 9.2981
>T257860 WP_010743953.1 NZ_CP104393:787525-787869 [Enterococcus raffinosus]
MVRMIKQGDIVKMNLDPKQGHEQKGYRPYICLSYKGVAMNSRIAIFAPISNTQRNYPLYVPVSAECKTTGKVLLDQLVAI
DFYHRDYSFVETVPDDFINDLLKKVKVIFQRDKE
MVRMIKQGDIVKMNLDPKQGHEQKGYRPYICLSYKGVAMNSRIAIFAPISNTQRNYPLYVPVSAECKTTGKVLLDQLVAI
DFYHRDYSFVETVPDDFINDLLKKVKVIFQRDKE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|