Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 772316..772940 | Replicon | chromosome |
| Accession | NZ_CP104392 | ||
| Organism | Enterococcus raffinosus strain HG-5 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | R2RF59 |
| Locus tag | N4S13_RS03800 | Protein ID | WP_010746644.1 |
| Coordinates | 772755..772940 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | R2QSL8 |
| Locus tag | N4S13_RS03795 | Protein ID | WP_010746645.1 |
| Coordinates | 772316..772702 (-) | Length | 129 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4S13_RS03770 (N4S13_03770) | 767938..768273 | + | 336 | WP_010746650.1 | hypothetical protein | - |
| N4S13_RS03775 (N4S13_03775) | 768641..769114 | + | 474 | WP_010746649.1 | hypothetical protein | - |
| N4S13_RS03780 (N4S13_03780) | 769118..770332 | + | 1215 | WP_010746648.1 | biotin/lipoyl-binding protein | - |
| N4S13_RS03785 (N4S13_03785) | 770333..771019 | + | 687 | WP_010746647.1 | ABC transporter ATP-binding protein | - |
| N4S13_RS03790 (N4S13_03790) | 771016..772215 | + | 1200 | WP_010746646.1 | ABC transporter permease | - |
| N4S13_RS03795 (N4S13_03795) | 772316..772702 | - | 387 | WP_010746645.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4S13_RS03800 (N4S13_03800) | 772755..772940 | - | 186 | WP_010746644.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4S13_RS03805 (N4S13_03805) | 773175..774110 | - | 936 | WP_010746643.1 | membrane protein insertase YidC | - |
| N4S13_RS03810 (N4S13_03810) | 774215..774487 | - | 273 | WP_010746642.1 | acylphosphatase | - |
| N4S13_RS03815 (N4S13_03815) | 774627..775388 | + | 762 | WP_010746641.1 | RNA methyltransferase | - |
| N4S13_RS03820 (N4S13_03820) | 775519..776016 | + | 498 | WP_010746640.1 | HD domain-containing protein | - |
| N4S13_RS03825 (N4S13_03825) | 776384..777016 | + | 633 | WP_010746639.1 | YitT family protein | - |
| N4S13_RS03830 (N4S13_03830) | 777189..777752 | + | 564 | WP_010746638.1 | elongation factor P | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7029.19 Da Isoelectric Point: 10.5745
>T257859 WP_010746644.1 NZ_CP104392:c772940-772755 [Enterococcus raffinosus]
MDAKELAKILKNDGWYFDSQRGSHRYYKHPIKKGKVPVPFHSHKDIPIGTLNNILKQAGLK
MDAKELAKILKNDGWYFDSQRGSHRYYKHPIKKGKVPVPFHSHKDIPIGTLNNILKQAGLK
Download Length: 186 bp
Antitoxin
Download Length: 129 a.a. Molecular weight: 14319.38 Da Isoelectric Point: 4.4698
>AT257859 WP_010746645.1 NZ_CP104392:c772702-772316 [Enterococcus raffinosus]
MVIYYAMFDFADNGINVVFPDLNNAATFGENMHEALYMAKDLLAGWLIDAEDEKQAFPSPTDHRSLSVAAGNLLIPIEVD
LSFYRKKFESKPIKKTLTIPKYLNDLGNEAGINFSATLTEALKEKLEV
MVIYYAMFDFADNGINVVFPDLNNAATFGENMHEALYMAKDLLAGWLIDAEDEKQAFPSPTDHRSLSVAAGNLLIPIEVD
LSFYRKKFESKPIKKTLTIPKYLNDLGNEAGINFSATLTEALKEKLEV
Download Length: 387 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|