Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 3261559..3262192 | Replicon | chromosome |
| Accession | NZ_CP104390 | ||
| Organism | Weizmannia coagulans strain JBI-YZ6.3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G2TIM0 |
| Locus tag | N4P52_RS15585 | Protein ID | WP_013860680.1 |
| Coordinates | 3261559..3261909 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | G2TIL9 |
| Locus tag | N4P52_RS15590 | Protein ID | WP_014096808.1 |
| Coordinates | 3261914..3262192 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4P52_RS15550 (N4P52_15550) | 3256819..3257598 | - | 780 | WP_019720971.1 | RNA polymerase sigma factor SigB | - |
| N4P52_RS15555 (N4P52_15555) | 3257576..3258046 | - | 471 | WP_168985761.1 | anti-sigma B factor RsbW | - |
| N4P52_RS15560 (N4P52_15560) | 3258050..3258379 | - | 330 | WP_013860674.1 | anti-sigma factor antagonist | - |
| N4P52_RS15565 (N4P52_15565) | 3258393..3259460 | - | 1068 | WP_168985762.1 | PP2C family protein-serine/threonine phosphatase | - |
| N4P52_RS15570 (N4P52_15570) | 3259475..3259876 | - | 402 | WP_013860676.1 | anti-sigma regulatory factor | - |
| N4P52_RS15575 (N4P52_15575) | 3259881..3260237 | - | 357 | WP_017553290.1 | STAS domain-containing protein | - |
| N4P52_RS15580 (N4P52_15580) | 3260241..3261068 | - | 828 | WP_168985763.1 | RsbT co-antagonist protein RsbRA | - |
| N4P52_RS15585 (N4P52_15585) | 3261559..3261909 | - | 351 | WP_013860680.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| N4P52_RS15590 (N4P52_15590) | 3261914..3262192 | - | 279 | WP_014096808.1 | hypothetical protein | Antitoxin |
| N4P52_RS15595 (N4P52_15595) | 3262345..3263496 | - | 1152 | WP_014096807.1 | alanine racemase | - |
| N4P52_RS15600 (N4P52_15600) | 3263698..3264714 | - | 1017 | WP_014096806.1 | outer membrane lipoprotein carrier protein LolA | - |
| N4P52_RS15605 (N4P52_15605) | 3264855..3265205 | - | 351 | WP_014096805.1 | holo-ACP synthase | - |
| N4P52_RS15610 (N4P52_15610) | 3265486..3266085 | + | 600 | WP_014096804.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12968.01 Da Isoelectric Point: 4.8998
>T257857 WP_013860680.1 NZ_CP104390:c3261909-3261559 [Weizmannia coagulans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4BYJ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4BX66 |