Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT_toxin-BrnA |
Location | 2733513..2733963 | Replicon | chromosome |
Accession | NZ_CP104386 | ||
Organism | Cupriavidus gilardii strain WM02 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | N4G38_RS12920 | Protein ID | WP_232963065.1 |
Coordinates | 2733513..2733626 (+) | Length | 38 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | - |
Locus tag | N4G38_RS12925 | Protein ID | WP_252252901.1 |
Coordinates | 2733610..2733963 (+) | Length | 118 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G38_RS12905 (N4G38_12905) | 2729690..2730397 | - | 708 | WP_174781321.1 | two-component system response regulator CreB | - |
N4G38_RS12910 (N4G38_12910) | 2730449..2731657 | - | 1209 | WP_260730575.1 | NAD(P)/FAD-dependent oxidoreductase | - |
N4G38_RS12915 (N4G38_12915) | 2732131..2733312 | + | 1182 | WP_198751423.1 | benzoate/H(+) symporter BenE family transporter | - |
N4G38_RS12920 (N4G38_12920) | 2733513..2733626 | + | 114 | WP_232963065.1 | hypothetical protein | Toxin |
N4G38_RS12925 (N4G38_12925) | 2733610..2733963 | + | 354 | WP_252252901.1 | BrnA antitoxin family protein | Antitoxin |
N4G38_RS12930 (N4G38_12930) | 2733971..2734831 | + | 861 | WP_260730576.1 | aminoglycoside 6-adenylyltransferase | - |
N4G38_RS12935 (N4G38_12935) | 2734958..2735653 | - | 696 | WP_252252903.1 | TrkA family potassium uptake protein | - |
N4G38_RS12940 (N4G38_12940) | 2735646..2736974 | - | 1329 | WP_260730577.1 | potassium transporter TrkG | - |
N4G38_RS12945 (N4G38_12945) | 2737359..2737790 | + | 432 | WP_053821272.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 38 a.a. Molecular weight: 4405.10 Da Isoelectric Point: 9.2738
>T257855 WP_232963065.1 NZ_CP104386:2733513-2733626 [Cupriavidus gilardii]
IGTRLHCLIFTIRGDTLRAISLRKANFREVRDYEQEI
IGTRLHCLIFTIRGDTLRAISLRKANFREVRDYEQEI
Download Length: 114 bp
Antitoxin
Download Length: 118 a.a. Molecular weight: 12988.94 Da Isoelectric Point: 10.6742
>AT257855 WP_252252901.1 NZ_CP104386:2733610-2733963 [Cupriavidus gilardii]
MNRKSKLTMPAADENAAIARGIADDPDAVELTTEQIKRMRPAREALAEVLGERNVEALIKRRGRPALPAAERKVSQTLRL
DPDVLQAFKATGDGWQTRINDALRAYAKSHRMLPRGC
MNRKSKLTMPAADENAAIARGIADDPDAVELTTEQIKRMRPAREALAEVLGERNVEALIKRRGRPALPAAERKVSQTLRL
DPDVLQAFKATGDGWQTRINDALRAYAKSHRMLPRGC
Download Length: 354 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|