Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 2342902..2343534 | Replicon | chromosome |
| Accession | NZ_CP104386 | ||
| Organism | Cupriavidus gilardii strain WM02 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0M5KT30 |
| Locus tag | N4G38_RS10990 | Protein ID | WP_053821538.1 |
| Coordinates | 2342902..2343078 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N4G38_RS10995 | Protein ID | WP_260730444.1 |
| Coordinates | 2343118..2343534 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4G38_RS10965 (N4G38_10965) | 2338250..2338750 | + | 501 | WP_023264649.1 | peptidylprolyl isomerase | - |
| N4G38_RS10970 (N4G38_10970) | 2338867..2339649 | + | 783 | WP_260730442.1 | UDP-2,3-diacylglucosamine diphosphatase | - |
| N4G38_RS10975 (N4G38_10975) | 2339700..2340443 | - | 744 | WP_174105791.1 | serine O-acetyltransferase | - |
| N4G38_RS10980 (N4G38_10980) | 2340804..2341724 | - | 921 | WP_260730443.1 | RNA methyltransferase | - |
| N4G38_RS10985 (N4G38_10985) | 2341917..2342735 | + | 819 | WP_064573223.1 | inositol monophosphatase family protein | - |
| N4G38_RS10990 (N4G38_10990) | 2342902..2343078 | + | 177 | WP_053821538.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4G38_RS10995 (N4G38_10995) | 2343118..2343534 | + | 417 | WP_260730444.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4G38_RS11000 (N4G38_11000) | 2343724..2346393 | + | 2670 | WP_082371422.1 | DNA mismatch repair protein MutS | - |
| N4G38_RS11005 (N4G38_11005) | 2346390..2347469 | + | 1080 | WP_260730445.1 | hypothetical protein | - |
| N4G38_RS11010 (N4G38_11010) | 2347545..2348072 | - | 528 | WP_006576455.1 | peptidylprolyl isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6588.65 Da Isoelectric Point: 11.9145
>T257854 WP_053821538.1 NZ_CP104386:2342902-2343078 [Cupriavidus gilardii]
VKQSEFRRWLGRQGATFADGGKHLKVYLNGRQSTMPRHPGKEIAERTRKAILKQLGLA
VKQSEFRRWLGRQGATFADGGKHLKVYLNGRQSTMPRHPGKEIAERTRKAILKQLGLA
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15361.59 Da Isoelectric Point: 4.3793
>AT257854 WP_260730444.1 NZ_CP104386:2343118-2343534 [Cupriavidus gilardii]
MLRYPVILTADDDGVAVSFPDIPEALTCGDSHEEALQMAADALVTAMEFYFEDRRPVPMPSAPEVGQELVDLPASLSAKV
LLLNEMLSQKVSQSELARRLDTRPQEVQRIVNLDHTTKIDTIEAAFRALGRRIELRIT
MLRYPVILTADDDGVAVSFPDIPEALTCGDSHEEALQMAADALVTAMEFYFEDRRPVPMPSAPEVGQELVDLPASLSAKV
LLLNEMLSQKVSQSELARRLDTRPQEVQRIVNLDHTTKIDTIEAAFRALGRRIELRIT
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|