Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 717898..718553 | Replicon | chromosome |
Accession | NZ_CP104386 | ||
Organism | Cupriavidus gilardii strain WM02 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | V2FYH0 |
Locus tag | N4G38_RS03370 | Protein ID | WP_006577198.1 |
Coordinates | 718152..718553 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N4G38_RS03365 | Protein ID | WP_260731043.1 |
Coordinates | 717898..718152 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4G38_RS03350 (N4G38_03350) | 713249..715216 | + | 1968 | WP_260731041.1 | hypothetical protein | - |
N4G38_RS03355 (N4G38_03355) | 715236..715850 | - | 615 | WP_006577195.1 | glutathione S-transferase N-terminal domain-containing protein | - |
N4G38_RS03360 (N4G38_03360) | 716268..717659 | + | 1392 | WP_260731042.1 | adenylosuccinate lyase | - |
N4G38_RS03365 (N4G38_03365) | 717898..718152 | + | 255 | WP_260731043.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N4G38_RS03370 (N4G38_03370) | 718152..718553 | + | 402 | WP_006577198.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4G38_RS03375 (N4G38_03375) | 718726..719274 | + | 549 | WP_260731044.1 | cytochrome b | - |
N4G38_RS03380 (N4G38_03380) | 719361..719933 | + | 573 | WP_053822490.1 | YceI family protein | - |
N4G38_RS03385 (N4G38_03385) | 720032..720622 | + | 591 | WP_174782151.1 | YceI family protein | - |
N4G38_RS03390 (N4G38_03390) | 721119..722510 | + | 1392 | WP_174782150.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14339.51 Da Isoelectric Point: 7.9095
>T257852 WP_006577198.1 NZ_CP104386:718152-718553 [Cupriavidus gilardii]
MALYLLDTNIVSAALRNTRGACAARIGMTDAGALCTSIVVAAELRFGVAKKGSAELARRVEHALSTLRVLPLDGDADRHY
GRLRTELERHGKPIGANDMLIAAHALAIDAVLVTDNVSEFSRVPGLRYENWLT
MALYLLDTNIVSAALRNTRGACAARIGMTDAGALCTSIVVAAELRFGVAKKGSAELARRVEHALSTLRVLPLDGDADRHY
GRLRTELERHGKPIGANDMLIAAHALAIDAVLVTDNVSEFSRVPGLRYENWLT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|