Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3675880..3676678 | Replicon | chromosome |
| Accession | NZ_CP104384 | ||
| Organism | Escherichia coli strain JNQH498 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A166U9J9 |
| Locus tag | KIG00_RS17970 | Protein ID | WP_000854695.1 |
| Coordinates | 3675880..3676257 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2U2UUE3 |
| Locus tag | KIG00_RS17975 | Protein ID | WP_016243360.1 |
| Coordinates | 3676304..3676678 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KIG00_RS17940 (3671669) | 3671669..3671794 | - | 126 | Protein_3512 | DUF4942 domain-containing protein | - |
| KIG00_RS17945 (3671964) | 3671964..3673505 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| KIG00_RS17950 (3673520) | 3673520..3674266 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| KIG00_RS17955 (3674337) | 3674337..3675101 | - | 765 | WP_241071018.1 | DUF4942 domain-containing protein | - |
| KIG00_RS17960 (3675186) | 3675186..3675383 | - | 198 | WP_000839228.1 | DUF957 domain-containing protein | - |
| KIG00_RS17965 (3675395) | 3675395..3675883 | - | 489 | WP_000761710.1 | DUF5983 family protein | - |
| KIG00_RS17970 (3675880) | 3675880..3676257 | - | 378 | WP_000854695.1 | TA system toxin CbtA family protein | Toxin |
| KIG00_RS17975 (3676304) | 3676304..3676678 | - | 375 | WP_016243360.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KIG00_RS17980 (3676841) | 3676841..3677062 | - | 222 | WP_000692307.1 | DUF987 domain-containing protein | - |
| KIG00_RS17985 (3677131) | 3677131..3677607 | - | 477 | WP_001186773.1 | RadC family protein | - |
| KIG00_RS17990 (3677623) | 3677623..3678102 | - | 480 | WP_000860084.1 | antirestriction protein | - |
| KIG00_RS17995 (3678184) | 3678184..3679002 | - | 819 | WP_001241366.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3643750..3678102 | 34352 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14062.03 Da Isoelectric Point: 7.7531
>T257846 WP_000854695.1 NZ_CP104384:c3676257-3675880 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPGAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13810.66 Da Isoelectric Point: 7.0266
>AT257846 WP_016243360.1 NZ_CP104384:c3676678-3676304 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A166U9J9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2U2UUE3 |