Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2420946..2421584 | Replicon | chromosome |
Accession | NZ_CP104384 | ||
Organism | Escherichia coli strain JNQH498 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | KIG00_RS11835 | Protein ID | WP_000813794.1 |
Coordinates | 2421408..2421584 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | KIG00_RS11830 | Protein ID | WP_001270286.1 |
Coordinates | 2420946..2421362 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KIG00_RS11810 (2416098) | 2416098..2417039 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
KIG00_RS11815 (2417040) | 2417040..2418053 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
KIG00_RS11820 (2418071) | 2418071..2419216 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
KIG00_RS11825 (2419461) | 2419461..2420867 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
KIG00_RS11830 (2420946) | 2420946..2421362 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
KIG00_RS11835 (2421408) | 2421408..2421584 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
KIG00_RS11840 (2421806) | 2421806..2422036 | + | 231 | WP_000494244.1 | YncJ family protein | - |
KIG00_RS11845 (2422128) | 2422128..2424089 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
KIG00_RS11850 (2424162) | 2424162..2424698 | - | 537 | WP_080317363.1 | DNA-binding transcriptional regulator SutR | - |
KIG00_RS11855 (2424751) | 2424751..2425965 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T257844 WP_000813794.1 NZ_CP104384:c2421584-2421408 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT257844 WP_001270286.1 NZ_CP104384:c2421362-2420946 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|