Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1777573..1778404 Replicon chromosome
Accession NZ_CP104384
Organism Escherichia coli strain JNQH498

Toxin (Protein)


Gene name yeeV Uniprot ID F4THW6
Locus tag KIG00_RS08395 Protein ID WP_000854818.1
Coordinates 1777573..1777947 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID F4THW5
Locus tag KIG00_RS08400 Protein ID WP_001313071.1
Coordinates 1778036..1778404 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KIG00_RS08360 (1773569) 1773569..1773898 + 330 WP_000450409.1 DUF496 family protein -
KIG00_RS08365 (1773999) 1773999..1774322 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
KIG00_RS08370 (1774301) 1774301..1774381 + 81 WP_023441679.1 hypothetical protein -
KIG00_RS08375 (1774745) 1774745..1775491 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
KIG00_RS08380 (1775506) 1775506..1777047 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
KIG00_RS08385 (1777256) 1777256..1777336 - 81 Protein_1637 hypothetical protein -
KIG00_RS08390 (1777382) 1777382..1777576 - 195 WP_000988600.1 DUF5983 family protein -
KIG00_RS08395 (1777573) 1777573..1777947 - 375 WP_000854818.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
KIG00_RS08400 (1778036) 1778036..1778404 - 369 WP_001313071.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
KIG00_RS08405 (1778484) 1778484..1778705 - 222 WP_000692301.1 DUF987 domain-containing protein -
KIG00_RS08410 (1778768) 1778768..1779244 - 477 WP_001186726.1 RadC family protein -
KIG00_RS08415 (1779260) 1779260..1779739 - 480 WP_000860076.1 antirestriction protein -
KIG00_RS08420 (1779821) 1779821..1780642 - 822 WP_001234530.1 DUF932 domain-containing protein -
KIG00_RS08425 (1780863) 1780863..1781273 - 411 WP_000846713.1 hypothetical protein -
KIG00_RS08430 (1781289) 1781289..1781972 - 684 WP_042004735.1 hypothetical protein -
KIG00_RS08435 (1782108) 1782108..1783178 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13972.98 Da        Isoelectric Point: 7.1333

>T257837 WP_000854818.1 NZ_CP104384:c1777947-1777573 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13498.23 Da        Isoelectric Point: 5.8696

>AT257837 WP_001313071.1 NZ_CP104384:c1778404-1778036 [Escherichia coli]
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3W3PHA3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1L2Z3

References