Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 28968..29611 Replicon plasmid unnamed1
Accession NZ_CP104374
Organism Klebsiella pneumoniae strain 2021CK-01815

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag N4558_RS26005 Protein ID WP_001044770.1
Coordinates 28968..29384 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag N4558_RS26010 Protein ID WP_001261282.1
Coordinates 29381..29611 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4558_RS25975 (N4558_25970) 24318..25106 + 789 WP_001206315.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 -
N4558_RS25980 (N4558_25975) 25166..25990 + 825 Protein_30 OXA-9 family oxacillin-hydrolyzing class D beta-lactamase -
N4558_RS25985 (N4558_25980) 26190..26507 + 318 Protein_31 recombinase family protein -
N4558_RS25990 (N4558_25985) 26690..27436 + 747 Protein_32 class A beta-lactamase -
N4558_RS26000 (N4558_25995) 28205..28894 - 690 Protein_34 ATP-binding protein -
N4558_RS26005 (N4558_26000) 28968..29384 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
N4558_RS26010 (N4558_26005) 29381..29611 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N4558_RS26015 (N4558_26010) 29568..30027 + 460 Protein_37 hypothetical protein -
N4558_RS26020 (N4558_26015) 30514..30822 + 309 WP_004152336.1 hypothetical protein -
N4558_RS26025 (N4558_26020) 30850..31179 + 330 WP_004152337.1 hypothetical protein -
N4558_RS26030 (N4558_26025) 31205..31603 + 399 WP_004171440.1 hypothetical protein -
N4558_RS26035 (N4558_26030) 31610..31942 + 333 WP_004152339.1 hypothetical protein -
N4558_RS26040 (N4558_26035) 31942..32724 + 783 WP_004152340.1 site-specific integrase -
N4558_RS26045 (N4558_26040) 33616..33846 - 231 WP_011977773.1 hypothetical protein -
N4558_RS26050 (N4558_26045) 33938..34411 - 474 WP_004152341.1 YkgJ family cysteine cluster protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 / aph(3')-VI / qnrS1 / blaCTX-M-15 / aac(6')-Ib / ant(3'')-Ia / blaOXA-9 / blaTEM-1B - 1..112409 112409
- flank IS/Tn - - 34531..35799 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T257829 WP_001044770.1 NZ_CP104374:c29384-28968 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT257829 WP_001261282.1 NZ_CP104374:c29611-29381 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References