Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5305083..5305708 | Replicon | chromosome |
Accession | NZ_CP104373 | ||
Organism | Klebsiella pneumoniae strain 2021CK-01815 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A378FVD4 |
Locus tag | N4558_RS25465 | Protein ID | WP_019705794.1 |
Coordinates | 5305083..5305466 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N4558_RS25470 | Protein ID | WP_168234151.1 |
Coordinates | 5305466..5305708 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4558_RS25450 (N4558_25445) | 5302449..5303351 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
N4558_RS25455 (N4558_25450) | 5303348..5303983 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
N4558_RS25460 (N4558_25455) | 5303980..5304909 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
N4558_RS25465 (N4558_25460) | 5305083..5305466 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4558_RS25470 (N4558_25465) | 5305466..5305708 | - | 243 | WP_168234151.1 | CopG family transcriptional regulator | Antitoxin |
N4558_RS25475 (N4558_25470) | 5305913..5306830 | + | 918 | WP_019705795.1 | alpha/beta hydrolase | - |
N4558_RS25480 (N4558_25475) | 5306844..5307785 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
N4558_RS25485 (N4558_25480) | 5307830..5308267 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
N4558_RS25490 (N4558_25485) | 5308264..5309124 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
N4558_RS25495 (N4558_25490) | 5309118..5309717 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T257828 WP_019705794.1 NZ_CP104373:c5305466-5305083 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|