Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4108317..4108936 Replicon chromosome
Accession NZ_CP104373
Organism Klebsiella pneumoniae strain 2021CK-01815

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N4558_RS19765 Protein ID WP_002892050.1
Coordinates 4108718..4108936 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N4558_RS19760 Protein ID WP_002892066.1
Coordinates 4108317..4108691 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4558_RS19750 (N4558_19745) 4103469..4104662 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N4558_RS19755 (N4558_19750) 4104685..4107831 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N4558_RS19760 (N4558_19755) 4108317..4108691 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N4558_RS19765 (N4558_19760) 4108718..4108936 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N4558_RS19770 (N4558_19765) 4109095..4109661 + 567 WP_002892030.1 maltose O-acetyltransferase -
N4558_RS19775 (N4558_19770) 4109633..4109773 - 141 WP_032409038.1 hypothetical protein -
N4558_RS19780 (N4558_19775) 4109794..4110264 + 471 WP_002892026.1 YlaC family protein -
N4558_RS19785 (N4558_19780) 4110239..4111689 - 1451 Protein_3884 PLP-dependent aminotransferase family protein -
N4558_RS19790 (N4558_19785) 4111790..4112488 + 699 WP_019705329.1 GNAT family protein -
N4558_RS19795 (N4558_19790) 4112485..4112625 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N4558_RS19800 (N4558_19795) 4112625..4112888 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T257824 WP_002892050.1 NZ_CP104373:4108718-4108936 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT257824 WP_002892066.1 NZ_CP104373:4108317-4108691 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References