Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 28968..29611 Replicon plasmid unnamed1
Accession NZ_CP104372
Organism Escherichia coli strain 2021CK-01784

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag N4502_RS23785 Protein ID WP_001044770.1
Coordinates 28968..29384 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag N4502_RS23790 Protein ID WP_001261282.1
Coordinates 29381..29611 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4502_RS23755 (N4502_23755) 24318..25106 + 789 WP_001206315.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 -
N4502_RS23760 (N4502_23760) 25166..25990 + 825 Protein_30 OXA-9 family oxacillin-hydrolyzing class D beta-lactamase -
N4502_RS23765 (N4502_23765) 26190..26507 + 318 Protein_31 recombinase family protein -
N4502_RS23770 (N4502_23770) 26690..27436 + 747 Protein_32 class A beta-lactamase -
N4502_RS23780 (N4502_23780) 28205..28894 - 690 Protein_34 ATP-binding protein -
N4502_RS23785 (N4502_23785) 28968..29384 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
N4502_RS23790 (N4502_23790) 29381..29611 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N4502_RS23795 (N4502_23795) 29568..30027 + 460 Protein_37 hypothetical protein -
N4502_RS23800 (N4502_23800) 30176..30310 + 135 WP_256340418.1 hypothetical protein -
N4502_RS23805 (N4502_23805) 30322..30468 + 147 WP_249557131.1 hypothetical protein -
N4502_RS23810 (N4502_23810) 30514..30822 + 309 WP_004152336.1 hypothetical protein -
N4502_RS23815 (N4502_23815) 30850..31179 + 330 WP_004152337.1 hypothetical protein -
N4502_RS23820 (N4502_23820) 31205..31603 + 399 WP_004171440.1 hypothetical protein -
N4502_RS23825 (N4502_23825) 31610..31942 + 333 WP_004152339.1 hypothetical protein -
N4502_RS23830 (N4502_23830) 31942..32724 + 783 WP_004152340.1 site-specific integrase -
N4502_RS23835 (N4502_23835) 33616..33846 - 231 WP_011977773.1 hypothetical protein -
N4502_RS23840 (N4502_23840) 33938..34411 - 474 WP_004152341.1 YkgJ family cysteine cluster protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 / aph(3')-VI / qnrS1 / blaCTX-M-15 / aac(6')-Ib / ant(3'')-Ia / blaOXA-9 / blaTEM-1B - 1..112409 112409
- flank IS/Tn - - 34531..35799 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T257814 WP_001044770.1 NZ_CP104372:c29384-28968 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT257814 WP_001261282.1 NZ_CP104372:c29611-29381 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References