Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4266406..4267024 | Replicon | chromosome |
| Accession | NZ_CP104371 | ||
| Organism | Escherichia coli strain 2021CK-01784 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | N4502_RS20495 | Protein ID | WP_001291435.1 |
| Coordinates | 4266406..4266624 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N4502_RS20500 | Protein ID | WP_000344800.1 |
| Coordinates | 4266650..4267024 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4502_RS20460 (4261695) | 4261695..4262267 | + | 573 | WP_000779833.1 | YbaY family lipoprotein | - |
| N4502_RS20465 (4262298) | 4262298..4262609 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| N4502_RS20475 (4262988) | 4262988..4263341 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| N4502_RS20480 (4263383) | 4263383..4264933 | - | 1551 | WP_001305493.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N4502_RS20485 (4265097) | 4265097..4265567 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| N4502_RS20490 (4265683) | 4265683..4266234 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| N4502_RS20495 (4266406) | 4266406..4266624 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| N4502_RS20500 (4266650) | 4266650..4267024 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N4502_RS20505 (4267570) | 4267570..4270719 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| N4502_RS20510 (4270742) | 4270742..4271935 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T257813 WP_001291435.1 NZ_CP104371:c4266624-4266406 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT257813 WP_000344800.1 NZ_CP104371:c4267024-4266650 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |