Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 3530571..3531166 | Replicon | chromosome |
| Accession | NZ_CP104371 | ||
| Organism | Escherichia coli strain 2021CK-01784 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | N4502_RS17005 | Protein ID | WP_000239581.1 |
| Coordinates | 3530816..3531166 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | N4502_RS17000 | Protein ID | WP_001223213.1 |
| Coordinates | 3530571..3530822 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4502_RS16990 (3526236) | 3526236..3530015 | + | 3780 | WP_039720326.1 | autotransporter assembly complex protein TamB | - |
| N4502_RS16995 (3530018) | 3530018..3530359 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| N4502_RS17000 (3530571) | 3530571..3530822 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| N4502_RS17005 (3530816) | 3530816..3531166 | + | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| N4502_RS17010 (3531245) | 3531245..3531775 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| N4502_RS17015 (3532085) | 3532085..3533041 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| N4502_RS17020 (3533181) | 3533181..3534683 | + | 1503 | WP_039720327.1 | sugar ABC transporter ATP-binding protein | - |
| N4502_RS17025 (3534697) | 3534697..3535719 | + | 1023 | WP_039720328.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T257809 WP_000239581.1 NZ_CP104371:3530816-3531166 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|