Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2787510..2788122 | Replicon | chromosome |
Accession | NZ_CP104371 | ||
Organism | Escherichia coli strain 2021CK-01784 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A167AMN3 |
Locus tag | N4502_RS13590 | Protein ID | WP_000833474.1 |
Coordinates | 2787937..2788122 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A1V3VHB3 |
Locus tag | N4502_RS13585 | Protein ID | WP_000499746.1 |
Coordinates | 2787510..2787920 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4502_RS13570 (2783022) | 2783022..2783837 | - | 816 | WP_000891823.1 | AraC family transcriptional regulator | - |
N4502_RS13575 (2784063) | 2784063..2785463 | + | 1401 | WP_000204804.1 | MFS transporter | - |
N4502_RS13580 (2785474) | 2785474..2787438 | + | 1965 | WP_001026871.1 | glycoside hydrolase family 127 protein | - |
N4502_RS13585 (2787510) | 2787510..2787920 | - | 411 | WP_000499746.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N4502_RS13590 (2787937) | 2787937..2788122 | - | 186 | WP_000833474.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N4502_RS13595 (2788391) | 2788391..2789929 | - | 1539 | WP_001306609.1 | aldehyde dehydrogenase AldB | - |
N4502_RS13600 (2790130) | 2790130..2791281 | - | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6819.94 Da Isoelectric Point: 12.0345
>T257807 WP_000833474.1 NZ_CP104371:c2788122-2787937 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSRHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSRHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15290.22 Da Isoelectric Point: 4.5486
>AT257807 WP_000499746.1 NZ_CP104371:c2787920-2787510 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A167AMN3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3VHB3 |