Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2016021..2016675 | Replicon | chromosome |
Accession | NZ_CP104371 | ||
Organism | Escherichia coli strain 2021CK-01784 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N4502_RS09800 | Protein ID | WP_000244781.1 |
Coordinates | 2016021..2016428 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N4502_RS09805 | Protein ID | WP_000354046.1 |
Coordinates | 2016409..2016675 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4502_RS09780 (2011978) | 2011978..2013711 | - | 1734 | WP_000813175.1 | single-stranded-DNA-specific exonuclease RecJ | - |
N4502_RS09785 (2013717) | 2013717..2014427 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N4502_RS09790 (2014452) | 2014452..2015348 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N4502_RS09795 (2015460) | 2015460..2015981 | + | 522 | WP_001055888.1 | flavodoxin FldB | - |
N4502_RS09800 (2016021) | 2016021..2016428 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
N4502_RS09805 (2016409) | 2016409..2016675 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N4502_RS09810 (2016918) | 2016918..2017898 | + | 981 | WP_000886051.1 | tRNA-modifying protein YgfZ | - |
N4502_RS09815 (2017975) | 2017975..2018634 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
N4502_RS09820 (2018798) | 2018798..2019109 | - | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
N4502_RS09825 (2019154) | 2019154..2020587 | + | 1434 | WP_001305827.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T257804 WP_000244781.1 NZ_CP104371:c2016428-2016021 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|