Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 1295756..1296461 | Replicon | chromosome |
| Accession | NZ_CP104371 | ||
| Organism | Escherichia coli strain 2021CK-01784 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | N4502_RS06355 | Protein ID | WP_000539521.1 |
| Coordinates | 1295756..1296142 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N4502_RS06360 | Protein ID | WP_001280945.1 |
| Coordinates | 1296132..1296461 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4502_RS06335 (1291760) | 1291760..1292386 | + | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
| N4502_RS06340 (1292383) | 1292383..1293498 | - | 1116 | WP_000555033.1 | aldose sugar dehydrogenase YliI | - |
| N4502_RS06345 (1293609) | 1293609..1293992 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| N4502_RS06350 (1294205) | 1294205..1295530 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| N4502_RS06355 (1295756) | 1295756..1296142 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4502_RS06360 (1296132) | 1296132..1296461 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| N4502_RS06365 (1296531) | 1296531..1297859 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
| N4502_RS06370 (1297867) | 1297867..1300215 | - | 2349 | Protein_1255 | EAL domain-containing protein | - |
| N4502_RS06375 (1300393) | 1300393..1301304 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T257803 WP_000539521.1 NZ_CP104371:1295756-1296142 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|