Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1027310..1028154 Replicon chromosome
Accession NZ_CP104371
Organism Escherichia coli strain 2021CK-01784

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag N4502_RS05130 Protein ID WP_000854686.1
Coordinates 1027310..1027693 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag N4502_RS05135 Protein ID WP_001285602.1
Coordinates 1027774..1028154 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4502_RS05090 (1022312) 1022312..1022803 - 492 WP_001309402.1 DUF1097 domain-containing protein -
N4502_RS05095 (1022905) 1022905..1023459 - 555 WP_001001909.1 molecular chaperone YcdY -
N4502_RS05100 (1023483) 1023483..1024220 - 738 WP_000283664.1 zinc-binding phosphatase -
N4502_RS05105 (1024275) 1024275..1025213 - 939 WP_000351282.1 glyoxylate/hydroxypyruvate reductase GhrA -
N4502_RS05115 (1025684) 1025684..1026526 - 843 WP_021513039.1 DUF4942 domain-containing protein -
N4502_RS05120 (1026611) 1026611..1026808 - 198 WP_000839253.1 DUF957 domain-containing protein -
N4502_RS05125 (1026825) 1026825..1027313 - 489 WP_001054233.1 DUF5983 family protein -
N4502_RS05130 (1027310) 1027310..1027693 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
N4502_RS05135 (1027774) 1027774..1028154 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N4502_RS05140 (1028165) 1028165..1028554 - 390 Protein_1011 antitoxin of toxin-antitoxin stability system -
N4502_RS05150 (1029813) 1029813..1030109 - 297 Protein_1013 antitoxin of toxin-antitoxin stability system -
N4502_RS05155 (1030128) 1030128..1030349 - 222 WP_001696890.1 DUF987 domain-containing protein -
N4502_RS05160 (1030412) 1030412..1030888 - 477 WP_001186726.1 RadC family protein -
N4502_RS05165 (1030904) 1030904..1031389 - 486 WP_001697217.1 antirestriction protein -
N4502_RS05170 (1031481) 1031481..1032299 - 819 WP_001697216.1 DUF932 domain-containing protein -
N4502_RS05175 (1032399) 1032399..1032632 - 234 WP_001119719.1 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG 1018693..1042123 23430


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T257802 WP_000854686.1 NZ_CP104371:c1027693-1027310 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT257802 WP_001285602.1 NZ_CP104371:c1028154-1027774 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References