Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 684082..684720 | Replicon | chromosome |
Accession | NZ_CP104371 | ||
Organism | Escherichia coli strain 2021CK-01784 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | D3GRG9 |
Locus tag | N4502_RS03380 | Protein ID | WP_001314712.1 |
Coordinates | 684544..684720 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N4502_RS03375 | Protein ID | WP_077248684.1 |
Coordinates | 684082..684498 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4502_RS03355 (679234) | 679234..680175 | - | 942 | WP_001251335.1 | ABC transporter permease | - |
N4502_RS03360 (680176) | 680176..681189 | - | 1014 | WP_000220407.1 | ABC transporter ATP-binding protein | - |
N4502_RS03365 (681207) | 681207..682352 | - | 1146 | WP_000047443.1 | ABC transporter substrate-binding protein | - |
N4502_RS03370 (682597) | 682597..684003 | - | 1407 | WP_000760623.1 | PLP-dependent aminotransferase family protein | - |
N4502_RS03375 (684082) | 684082..684498 | - | 417 | WP_077248684.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N4502_RS03380 (684544) | 684544..684720 | - | 177 | WP_001314712.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N4502_RS03385 (684942) | 684942..685172 | + | 231 | WP_000494241.1 | YncJ family protein | - |
N4502_RS03390 (685264) | 685264..687225 | - | 1962 | WP_260837354.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N4502_RS03395 (687298) | 687298..687834 | - | 537 | WP_000429149.1 | DNA-binding transcriptional regulator SutR | - |
N4502_RS03400 (687926) | 687926..689098 | + | 1173 | WP_001236274.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6746.81 Da Isoelectric Point: 11.8888
>T257800 WP_001314712.1 NZ_CP104371:c684720-684544 [Escherichia coli]
VKQSEFRRWLESQGVNVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVNVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15232.60 Da Isoelectric Point: 4.7286
>AT257800 WP_077248684.1 NZ_CP104371:c684498-684082 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSDITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSDITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|