Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3523423..3524043 | Replicon | chromosome |
Accession | NZ_CP104366 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain PNUSAS028809 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N4533_RS17455 | Protein ID | WP_001280991.1 |
Coordinates | 3523825..3524043 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | N4533_RS17450 | Protein ID | WP_000344807.1 |
Coordinates | 3523423..3523797 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4533_RS17440 (3518562) | 3518562..3519755 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N4533_RS17445 (3519778) | 3519778..3522927 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
N4533_RS17450 (3523423) | 3523423..3523797 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
N4533_RS17455 (3523825) | 3523825..3524043 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N4533_RS17460 (3524222) | 3524222..3524773 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
N4533_RS17465 (3524890) | 3524890..3525360 | + | 471 | WP_000136181.1 | YlaC family protein | - |
N4533_RS17470 (3525416) | 3525416..3525556 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
N4533_RS17475 (3525562) | 3525562..3525822 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
N4533_RS17480 (3526047) | 3526047..3527597 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
N4533_RS17490 (3527828) | 3527828..3528217 | + | 390 | WP_000961285.1 | MGMT family protein | - |
N4533_RS17495 (3528250) | 3528250..3528819 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T257785 WP_001280991.1 NZ_CP104366:3523825-3524043 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT257785 WP_000344807.1 NZ_CP104366:3523423-3523797 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|