Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3987221..3987797 | Replicon | chromosome |
| Accession | NZ_CP104358 | ||
| Organism | Salmonella enterica strain PNUSAS119065 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | N4275_RS19455 | Protein ID | WP_001131963.1 |
| Coordinates | 3987510..3987797 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | B5R9R5 |
| Locus tag | N4275_RS19450 | Protein ID | WP_000063142.1 |
| Coordinates | 3987221..3987523 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4275_RS19435 (3983731) | 3983731..3985881 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
| N4275_RS19440 (3985976) | 3985976..3986179 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| N4275_RS19445 (3986190) | 3986190..3987146 | + | 957 | WP_000187843.1 | GTPase | - |
| N4275_RS19450 (3987221) | 3987221..3987523 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
| N4275_RS19455 (3987510) | 3987510..3987797 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| N4275_RS19460 (3988207) | 3988207..3990048 | + | 1842 | WP_000974636.1 | nuclease-related domain-containing DEAD/DEAH box helicase | - |
| N4275_RS19465 (3990661) | 3990661..3991236 | + | 576 | WP_000593784.1 | restriction endonuclease subunit S | - |
| N4275_RS19470 (3991241) | 3991241..3992494 | + | 1254 | WP_001206755.1 | N-6 DNA methylase | - |
| N4275_RS19475 (3992526) | 3992526..3992660 | - | 135 | WP_001055725.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T257748 WP_001131963.1 NZ_CP104358:c3987797-3987510 [Salmonella enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 | |
| AlphaFold DB | A0A4D6PB01 |