Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc(toxin)
Location 661798..662369 Replicon chromosome
Accession NZ_CP104357
Organism Vibrio cholerae strain PNUSAV001141

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag N4269_RS16880 Protein ID WP_134987537.1
Coordinates 661968..662369 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID Q8GNG3
Locus tag N4269_RS16875 Protein ID WP_001080654.1
Coordinates 661798..661968 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4269_RS16840 (N4269_16840) 657080..657766 + 687 WP_230666932.1 hypothetical protein -
N4269_RS16845 (N4269_16845) 657750..658178 + 429 WP_000082746.1 hypothetical protein -
N4269_RS16850 (N4269_16850) 658872..659789 + 918 WP_134987535.1 alpha/beta hydrolase -
N4269_RS16855 (N4269_16855) 659852..660028 + 177 WP_134987536.1 acetyltransferase -
N4269_RS16860 (N4269_16860) 660137..660271 + 135 Protein_675 DUF645 family protein -
N4269_RS16865 (N4269_16865) 661004..661291 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4269_RS16870 (N4269_16870) 661302..661619 + 318 WP_001232701.1 HigA family addiction module antitoxin -
N4269_RS16875 (N4269_16875) 661798..661968 + 171 WP_001080654.1 hypothetical protein Antitoxin
N4269_RS16880 (N4269_16880) 661968..662369 + 402 WP_134987537.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N4269_RS16885 (N4269_16885) 662432..662634 + 203 Protein_680 acetyltransferase -
N4269_RS16890 (N4269_16890) 662642..662824 + 183 WP_000093413.1 DUF645 family protein -
N4269_RS16895 (N4269_16895) 663018..663488 - 471 WP_000784954.1 RES family NAD+ phosphorylase -
N4269_RS16900 (N4269_16900) 663488..663940 - 453 WP_000024295.1 DUF2384 domain-containing protein -
N4269_RS16905 (N4269_16905) 664162..664638 + 477 WP_085604293.1 GNAT family N-acetyltransferase -
N4269_RS16910 (N4269_16910) 664661..664819 - 159 Protein_685 IS30 family transposase -
N4269_RS16915 (N4269_16915) 664979..665139 + 161 Protein_686 DUF645 family protein -
N4269_RS16920 (N4269_16920) 665093..665526 + 434 Protein_687 IS200/IS605 family transposase -
N4269_RS16925 (N4269_16925) 665605..666078 - 474 WP_000034756.1 FKBP-type peptidyl-prolyl cis-trans isomerase -
N4269_RS16930 (N4269_16930) 666300..666914 + 615 WP_002054141.1 OmpA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 557944..665509 107565
- flank IS/Tn - - 664979..665509 530
- inside Integron - - 559057..664638 105581


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-132)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14651.74 Da        Isoelectric Point: 4.0904

>T257733 WP_134987537.1 NZ_CP104357:661968-662369 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHARPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Download         Length: 402 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6287.35 Da        Isoelectric Point: 10.7274

>AT257733 WP_001080654.1 NZ_CP104357:661798-661968 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SJJ1

References