Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 655219..655766 Replicon chromosome
Accession NZ_CP104357
Organism Vibrio cholerae strain PNUSAV001141

Toxin (Protein)


Gene name relE Uniprot ID D7HHP0
Locus tag N4269_RS16830 Protein ID WP_000229320.1
Coordinates 655464..655766 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag N4269_RS16825 Protein ID WP_000861987.1
Coordinates 655219..655476 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4269_RS16795 (N4269_16795) 650259..650501 + 243 WP_033933251.1 hypothetical protein -
N4269_RS16800 (N4269_16800) 650654..651646 + 993 WP_170887264.1 hypothetical protein -
N4269_RS16805 (N4269_16805) 651669..652628 - 960 WP_134987445.1 IS30 family transposase -
N4269_RS16810 (N4269_16810) 653331..653867 + 537 WP_019281268.1 GNAT family protein -
N4269_RS16815 (N4269_16815) 654034..654492 + 459 WP_134987534.1 hypothetical protein -
N4269_RS16820 (N4269_16820) 654788..654970 + 183 WP_000947519.1 DUF645 family protein -
N4269_RS16825 (N4269_16825) 655219..655476 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4269_RS16830 (N4269_16830) 655464..655766 + 303 WP_000229320.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4269_RS16835 (N4269_16835) 655905..656567 + 663 WP_000084914.1 Vat family streptogramin A O-acetyltransferase -
N4269_RS16840 (N4269_16840) 657080..657766 + 687 WP_230666932.1 hypothetical protein -
N4269_RS16845 (N4269_16845) 657750..658178 + 429 WP_000082746.1 hypothetical protein -
N4269_RS16850 (N4269_16850) 658872..659789 + 918 WP_134987535.1 alpha/beta hydrolase -
N4269_RS16855 (N4269_16855) 659852..660028 + 177 WP_134987536.1 acetyltransferase -
N4269_RS16860 (N4269_16860) 660137..660271 + 135 Protein_675 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 557944..665509 107565
- inside Integron - - 559057..664638 105581


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11682.58 Da        Isoelectric Point: 4.8838

>T257731 WP_000229320.1 NZ_CP104357:655464-655766 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKI
SILFVMRAERDLRRLMLTKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT257731 WP_000861987.1 NZ_CP104357:655219-655476 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D7HHP0

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References