Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-Phd |
Location | 655219..655766 | Replicon | chromosome |
Accession | NZ_CP104355 | ||
Organism | Vibrio cholerae strain PNUSAV001140 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D7HHP0 |
Locus tag | N4267_RS16835 | Protein ID | WP_000229320.1 |
Coordinates | 655464..655766 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q9KM93 |
Locus tag | N4267_RS16830 | Protein ID | WP_000861987.1 |
Coordinates | 655219..655476 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4267_RS16800 (N4267_16800) | 650259..650501 | + | 243 | WP_033933251.1 | hypothetical protein | - |
N4267_RS16805 (N4267_16805) | 650654..651646 | + | 993 | WP_170887264.1 | hypothetical protein | - |
N4267_RS16810 (N4267_16810) | 651669..652628 | - | 960 | WP_134987445.1 | IS30 family transposase | - |
N4267_RS16815 (N4267_16815) | 653331..653867 | + | 537 | WP_019281268.1 | GNAT family protein | - |
N4267_RS16820 (N4267_16820) | 654034..654492 | + | 459 | WP_134987534.1 | hypothetical protein | - |
N4267_RS16825 (N4267_16825) | 654788..654970 | + | 183 | WP_000947519.1 | DUF645 family protein | - |
N4267_RS16830 (N4267_16830) | 655219..655476 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N4267_RS16835 (N4267_16835) | 655464..655766 | + | 303 | WP_000229320.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4267_RS16840 (N4267_16840) | 655905..656567 | + | 663 | WP_000084914.1 | Vat family streptogramin A O-acetyltransferase | - |
N4267_RS16845 (N4267_16845) | 657080..657766 | + | 687 | WP_230666932.1 | hypothetical protein | - |
N4267_RS16850 (N4267_16850) | 657750..658178 | + | 429 | WP_000082746.1 | hypothetical protein | - |
N4267_RS16855 (N4267_16855) | 658872..659789 | + | 918 | WP_134987535.1 | alpha/beta hydrolase | - |
N4267_RS16860 (N4267_16860) | 659852..660028 | + | 177 | WP_134987536.1 | acetyltransferase | - |
N4267_RS16865 (N4267_16865) | 660137..660271 | + | 135 | Protein_676 | DUF645 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | - | 559057..664638 | 105581 | |
- | inside | Genomic island | - | - | 557944..665509 | 107565 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11682.58 Da Isoelectric Point: 4.8838
>T257720 WP_000229320.1 NZ_CP104355:655464-655766 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKI
SILFVMRAERDLRRLMLTKQ
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKI
SILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D7HHP0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1T4SLM9 |