Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 644924..645471 | Replicon | chromosome |
| Accession | NZ_CP104355 | ||
| Organism | Vibrio cholerae strain PNUSAV001140 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N4267_RS16730 | Protein ID | WP_033930520.1 |
| Coordinates | 645169..645471 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KM93 |
| Locus tag | N4267_RS16725 | Protein ID | WP_000861987.1 |
| Coordinates | 644924..645181 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4267_RS16690 (N4267_16690) | 640457..640921 | + | 465 | WP_032473198.1 | ASCH domain-containing protein | - |
| N4267_RS16695 (N4267_16695) | 641067..641987 | + | 921 | WP_134987527.1 | hypothetical protein | - |
| N4267_RS16700 (N4267_16700) | 641984..642601 | + | 618 | WP_175248455.1 | hypothetical protein | - |
| N4267_RS16705 (N4267_16705) | 642574..642708 | + | 135 | WP_175248611.1 | DUF3265 domain-containing protein | - |
| N4267_RS16710 (N4267_16710) | 642745..643284 | + | 540 | WP_000884560.1 | hydrolase | - |
| N4267_RS16715 (N4267_16715) | 643447..644226 | + | 780 | WP_001887508.1 | NYN domain-containing protein | - |
| N4267_RS16720 (N4267_16720) | 644557..644674 | + | 118 | Protein_647 | DUF645 family protein | - |
| N4267_RS16725 (N4267_16725) | 644924..645181 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N4267_RS16730 (N4267_16730) | 645169..645471 | + | 303 | WP_033930520.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4267_RS16735 (N4267_16735) | 645632..646120 | + | 489 | WP_033933186.1 | hypothetical protein | - |
| N4267_RS16740 (N4267_16740) | 646186..646352 | + | 167 | Protein_651 | acetyltransferase | - |
| N4267_RS16745 (N4267_16745) | 646413..646565 | + | 153 | Protein_652 | DUF645 family protein | - |
| N4267_RS16750 (N4267_16750) | 646772..647197 | + | 426 | WP_061051384.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
| N4267_RS16755 (N4267_16755) | 647481..647756 | + | 276 | WP_113629420.1 | hypothetical protein | - |
| N4267_RS16760 (N4267_16760) | 647762..648247 | + | 486 | WP_113629421.1 | hypothetical protein | - |
| N4267_RS16765 (N4267_16765) | 648285..648404 | + | 120 | WP_113629423.1 | DUF3265 domain-containing protein | - |
| N4267_RS16770 (N4267_16770) | 648437..648934 | - | 498 | WP_000982260.1 | GNAT family N-acetyltransferase | - |
| N4267_RS16775 (N4267_16775) | 648931..649203 | - | 273 | WP_134987530.1 | DUF1778 domain-containing protein | - |
| N4267_RS16780 (N4267_16780) | 649355..649531 | + | 177 | WP_134987531.1 | acetyltransferase | - |
| N4267_RS16785 (N4267_16785) | 649620..649772 | + | 153 | WP_175248612.1 | DUF645 family protein | - |
| N4267_RS16790 (N4267_16790) | 649887..649985 | + | 99 | WP_200894328.1 | acetyltransferase | - |
| N4267_RS16795 (N4267_16795) | 650006..650272 | + | 267 | WP_000589156.1 | BrnT family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 557944..665509 | 107565 | |
| - | inside | Integron | - | - | 559057..664638 | 105581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11695.54 Da Isoelectric Point: 4.8838
>T257716 WP_033930520.1 NZ_CP104355:645169-645471 [Vibrio cholerae]
MAEIVWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRIPPELEHLNYREVVVNPCRVFYKYDDANV
RILFVMRAERDLRRLMLTKQ
MAEIVWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRIPPELEHLNYREVVVNPCRVFYKYDDANV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|