257715

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 629273..629838 Replicon chromosome
Accession NZ_CP104355
Organism Vibrio cholerae strain PNUSAV001140

Toxin (Protein)


Gene name relE Uniprot ID D7HCW8
Locus tag N4267_RS16565 Protein ID WP_000869999.1
Coordinates 629551..629838 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D0IIK3
Locus tag N4267_RS16560 Protein ID WP_000086649.1
Coordinates 629273..629554 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4267_RS16500 (N4267_16500) 624410..624544 + 135 WP_123161857.1 acetyltransferase -
N4267_RS16505 (N4267_16505) 624528..624764 - 237 WP_000772130.1 RNA-binding protein -
N4267_RS16510 (N4267_16510) 625181..625264 + 84 WP_254702147.1 DUF645 family protein -
N4267_RS16515 (N4267_16515) 625306..625356 + 51 Protein_606 DUF645 family protein -
N4267_RS16520 (N4267_16520) 625715..625758 + 44 Protein_607 hypothetical protein -
N4267_RS16525 (N4267_16525) 625740..625833 + 94 Protein_608 ggdef family protein -
N4267_RS16530 (N4267_16530) 625802..625933 + 132 WP_080281197.1 cell shape-determining protein MreC -
N4267_RS16535 (N4267_16535) 626157..626546 + 390 WP_000491265.1 VOC family protein -
N4267_RS16540 (N4267_16540) 626882..627034 + 153 Protein_611 DUF645 family protein -
N4267_RS16545 (N4267_16545) 627234..627995 + 762 WP_134987519.1 hypothetical protein -
N4267_RS16550 (N4267_16550) 628018..628977 - 960 WP_134987445.1 IS30 family transposase -
N4267_RS16555 (N4267_16555) 629057..629182 + 126 WP_088129378.1 DUF3265 domain-containing protein -
N4267_RS16560 (N4267_16560) 629273..629554 + 282 WP_000086649.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N4267_RS16565 (N4267_16565) 629551..629838 + 288 WP_000869999.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4267_RS16570 (N4267_16570) 629918..630103 + 186 Protein_617 DUF3709 domain-containing protein -
N4267_RS16575 (N4267_16575) 630235..630294 + 60 WP_233423192.1 DUF3709 domain-containing protein -
N4267_RS16580 (N4267_16580) 630682..630939 + 258 WP_001893682.1 hypothetical protein -
N4267_RS16585 (N4267_16585) 631109..631690 + 582 WP_162796777.1 hypothetical protein -
N4267_RS16590 (N4267_16590) 631986..632111 + 126 Protein_621 DUF645 family protein -
N4267_RS16595 (N4267_16595) 632077..632193 + 117 WP_079993838.1 Tfp pilus assembly protein -
N4267_RS16600 (N4267_16600) 632370..632888 + 519 WP_134987521.1 GNAT family N-acetyltransferase -
N4267_RS16605 (N4267_16605) 632945..633007 + 63 Protein_624 acetyltransferase -
N4267_RS16610 (N4267_16610) 633047..633460 + 414 WP_102787204.1 GNAT family N-acetyltransferase -
N4267_RS16615 (N4267_16615) 633671..634132 + 462 WP_254702409.1 lipocalin family protein -
N4267_RS16620 (N4267_16620) 634231..634416 + 186 WP_235866184.1 disulfide bond formation protein DsbD -
N4267_RS16625 (N4267_16625) 634404..634646 + 243 WP_260813268.1 DUF3709 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 557944..665509 107565
- inside Integron - - 559057..664638 105581


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10997.74 Da        Isoelectric Point: 6.0710

>T257715 WP_000869999.1 NZ_CP104355:629551-629838 [Vibrio cholerae]
MKVVWSPLALQKLGDAAEFIALDNPSAAEKWVNEVFDKTELLGSMPEMGRMVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQLLTEHDV

Download         Length: 288 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10361.93 Da        Isoelectric Point: 5.1548

>AT257715 WP_000086649.1 NZ_CP104355:629273-629554 [Vibrio cholerae]
MSRIHLDQDIQPLSEFRAGVASFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLAAGLGISN
EDARSQVLGRIIK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3AEF1

Antitoxin

Source ID Structure
AlphaFold DB A0A0K9UIW4

References