Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2829313..2829992 | Replicon | chromosome |
| Accession | NZ_CP104351 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01335 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2S4SYJ5 |
| Locus tag | N4T38_RS14280 | Protein ID | WP_002108505.1 |
| Coordinates | 2829810..2829992 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N4T38_RS14275 | Protein ID | WP_000966688.1 |
| Coordinates | 2829313..2829717 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T38_RS14255 (N4T38_14255) | 2827482..2828228 | - | 747 | WP_000599536.1 | hypothetical protein | - |
| N4T38_RS14260 (N4T38_14260) | 2828290..2828673 | - | 384 | WP_000725050.1 | hypothetical protein | - |
| N4T38_RS14265 (N4T38_14265) | 2828706..2829029 | - | 324 | WP_000523928.1 | DUF4236 domain-containing protein | - |
| N4T38_RS14270 (N4T38_14270) | 2829038..2829214 | - | 177 | WP_075149899.1 | hypothetical protein | - |
| N4T38_RS14275 (N4T38_14275) | 2829313..2829717 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4T38_RS14280 (N4T38_14280) | 2829810..2829992 | - | 183 | WP_002108505.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4T38_RS14285 (N4T38_14285) | 2830318..2830833 | - | 516 | WP_001185610.1 | hypothetical protein | - |
| N4T38_RS14290 (N4T38_14290) | 2830903..2831820 | - | 918 | WP_024435783.1 | phage tail tube protein | - |
| N4T38_RS14295 (N4T38_14295) | 2831873..2833021 | - | 1149 | WP_033841386.1 | hypothetical protein | - |
| N4T38_RS14300 (N4T38_14300) | 2833021..2833374 | - | 354 | WP_031975507.1 | hypothetical protein | - |
| N4T38_RS14305 (N4T38_14305) | 2833470..2833688 | - | 219 | WP_001277694.1 | hypothetical protein | - |
| N4T38_RS14310 (N4T38_14310) | 2833690..2834088 | - | 399 | WP_025466443.1 | phage tail terminator-like protein | - |
| N4T38_RS14315 (N4T38_14315) | 2834090..2834458 | - | 369 | WP_025466445.1 | hypothetical protein | - |
| N4T38_RS14320 (N4T38_14320) | 2834430..2834837 | - | 408 | WP_000255076.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2813429..2862945 | 49516 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6685.80 Da Isoelectric Point: 10.5523
>T257708 WP_002108505.1 NZ_CP104351:c2829992-2829810 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257708 WP_000966688.1 NZ_CP104351:c2829717-2829313 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4SYJ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9L2H6 |