Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 477912..478565 | Replicon | chromosome |
Accession | NZ_CP104351 | ||
Organism | Acinetobacter baumannii strain 2021CK-01335 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A427QZH0 |
Locus tag | N4T38_RS02345 | Protein ID | WP_000931891.1 |
Coordinates | 478176..478565 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | N4T38_RS02340 | Protein ID | WP_001288210.1 |
Coordinates | 477912..478169 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T38_RS02320 (N4T38_02320) | 473427..474434 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
N4T38_RS02325 (N4T38_02325) | 474453..474830 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
N4T38_RS02330 (N4T38_02330) | 475012..476502 | + | 1491 | WP_000415132.1 | NAD(P)/FAD-dependent oxidoreductase | - |
N4T38_RS02335 (N4T38_02335) | 476552..477724 | - | 1173 | WP_001190558.1 | acyl-CoA dehydrogenase family protein | - |
N4T38_RS02340 (N4T38_02340) | 477912..478169 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
N4T38_RS02345 (N4T38_02345) | 478176..478565 | + | 390 | WP_000931891.1 | hypothetical protein | Toxin |
N4T38_RS02350 (N4T38_02350) | 479335..480420 | + | 1086 | WP_000049104.1 | hypothetical protein | - |
N4T38_RS02355 (N4T38_02355) | 480498..481064 | + | 567 | WP_000651536.1 | rhombosortase | - |
N4T38_RS02360 (N4T38_02360) | 481252..483447 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15635.91 Da Isoelectric Point: 10.3890
>T257706 WP_000931891.1 NZ_CP104351:478176-478565 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A427QZH0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BQM7 |