257702

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 11866..12450 Replicon plasmid unnamed2
Accession NZ_CP104348
Organism Acinetobacter baumannii strain 2021CK-01333

Toxin (Protein)


Gene name PumA Uniprot ID N8Q7V3
Locus tag N4T37_RS00090 Protein ID WP_000286964.1
Coordinates 12148..12450 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag N4T37_RS00085 Protein ID WP_000985609.1
Coordinates 11866..12147 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T37_RS00055 (N4T37_00055) 6933..7544 + 612 WP_015060246.1 recombinase family protein -
N4T37_RS00060 (N4T37_00060) 7734..8618 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
N4T37_RS00065 (N4T37_00065) 8674..10149 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
N4T37_RS00070 (N4T37_00070) 10642..10914 - 273 WP_000369781.1 NadS family protein -
N4T37_RS00075 (N4T37_00075) 10907..11227 - 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4T37_RS00080 (N4T37_00080) 11367..11786 + 420 WP_001180106.1 SMI1/KNR4 family protein -
N4T37_RS00085 (N4T37_00085) 11866..12147 - 282 WP_000985609.1 putative addiction module antidote protein Antitoxin
N4T37_RS00090 (N4T37_00090) 12148..12450 - 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4T37_RS00095 (N4T37_00095) 12652..13620 - 969 WP_252513945.1 IS30 family transposase -
N4T37_RS00100 (N4T37_00100) 13698..14141 + 444 WP_260744098.1 hypothetical protein -
N4T37_RS00105 (N4T37_00105) 14308..14622 - 315 WP_004728120.1 BrnA antitoxin family protein -
N4T37_RS00110 (N4T37_00110) 14609..14896 - 288 WP_000438825.1 BrnT family toxin -
N4T37_RS00115 (N4T37_00115) 15086..15922 - 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -
N4T37_RS00120 (N4T37_00120) 15922..16725 - 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
N4T37_RS00125 (N4T37_00125) 16791..17405 - 615 WP_125281634.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib - 7734..25563 17829
- inside Non-Mobilizable plasmid mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib / sul2 / tet(X3) / blaOXA-58 / aph(3')-VI / blaNDM-1 / ARR-3 - 1..335558 335558


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-90)

Antitoxin

Uncharacterized protein HI1420

(4-91)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11573.07 Da        Isoelectric Point: 4.6838

>T257702 WP_000286964.1 NZ_CP104348:c12450-12148 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL

Download         Length: 303 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10109.67 Da        Isoelectric Point: 8.0018

>AT257702 WP_000985609.1 NZ_CP104348:c12147-11866 [Acinetobacter baumannii]
MAIKLRKWDSAEHLKTEDDMQAYLQACIEESNGDAAFIAKALGNIAKAKGMAQLSRDTGLGRESLYKALSGDVNPSFDTV
IKVVKALNLRLAI

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TV94

Antitoxin

Source ID Structure

References