Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 11866..12450 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP104348 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01333 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | N8Q7V3 |
| Locus tag | N4T37_RS00090 | Protein ID | WP_000286964.1 |
| Coordinates | 12148..12450 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N4T37_RS00085 | Protein ID | WP_000985609.1 |
| Coordinates | 11866..12147 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T37_RS00055 (N4T37_00055) | 6933..7544 | + | 612 | WP_015060246.1 | recombinase family protein | - |
| N4T37_RS00060 (N4T37_00060) | 7734..8618 | - | 885 | WP_000155092.1 | Mph(E) family macrolide 2'-phosphotransferase | - |
| N4T37_RS00065 (N4T37_00065) | 8674..10149 | - | 1476 | WP_000052512.1 | ABC-F type ribosomal protection protein Msr(E) | - |
| N4T37_RS00070 (N4T37_00070) | 10642..10914 | - | 273 | WP_000369781.1 | NadS family protein | - |
| N4T37_RS00075 (N4T37_00075) | 10907..11227 | - | 321 | WP_000897307.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N4T37_RS00080 (N4T37_00080) | 11367..11786 | + | 420 | WP_001180106.1 | SMI1/KNR4 family protein | - |
| N4T37_RS00085 (N4T37_00085) | 11866..12147 | - | 282 | WP_000985609.1 | putative addiction module antidote protein | Antitoxin |
| N4T37_RS00090 (N4T37_00090) | 12148..12450 | - | 303 | WP_000286964.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4T37_RS00095 (N4T37_00095) | 12652..13620 | - | 969 | WP_252513945.1 | IS30 family transposase | - |
| N4T37_RS00100 (N4T37_00100) | 13698..14141 | + | 444 | WP_260744098.1 | hypothetical protein | - |
| N4T37_RS00105 (N4T37_00105) | 14308..14622 | - | 315 | WP_004728120.1 | BrnA antitoxin family protein | - |
| N4T37_RS00110 (N4T37_00110) | 14609..14896 | - | 288 | WP_000438825.1 | BrnT family toxin | - |
| N4T37_RS00115 (N4T37_00115) | 15086..15922 | - | 837 | WP_040110386.1 | APH(6)-I family aminoglycoside O-phosphotransferase | - |
| N4T37_RS00120 (N4T37_00120) | 15922..16725 | - | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| N4T37_RS00125 (N4T37_00125) | 16791..17405 | - | 615 | WP_125281634.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib | - | 7734..25563 | 17829 | |
| - | inside | Non-Mobilizable plasmid | mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib / sul2 / tet(X3) / blaOXA-58 / aph(3')-VI / blaNDM-1 / ARR-3 | - | 1..335558 | 335558 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11573.07 Da Isoelectric Point: 4.6838
>T257702 WP_000286964.1 NZ_CP104348:c12450-12148 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|