Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2470515..2471194 | Replicon | chromosome |
| Accession | NZ_CP104347 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01332 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2S4SYJ5 |
| Locus tag | N4T36_RS14610 | Protein ID | WP_002108505.1 |
| Coordinates | 2471012..2471194 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N4T36_RS14605 | Protein ID | WP_000966688.1 |
| Coordinates | 2470515..2470919 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T36_RS14585 (N4T36_14585) | 2468684..2469430 | - | 747 | WP_000599536.1 | hypothetical protein | - |
| N4T36_RS14590 (N4T36_14590) | 2469492..2469875 | - | 384 | WP_000725050.1 | hypothetical protein | - |
| N4T36_RS14595 (N4T36_14595) | 2469908..2470231 | - | 324 | WP_000523928.1 | DUF4236 domain-containing protein | - |
| N4T36_RS14600 (N4T36_14600) | 2470240..2470416 | - | 177 | WP_075149899.1 | hypothetical protein | - |
| N4T36_RS14605 (N4T36_14605) | 2470515..2470919 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4T36_RS14610 (N4T36_14610) | 2471012..2471194 | - | 183 | WP_002108505.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4T36_RS14615 (N4T36_14615) | 2471520..2472035 | - | 516 | WP_001185610.1 | hypothetical protein | - |
| N4T36_RS14620 (N4T36_14620) | 2472105..2473022 | - | 918 | WP_000094249.1 | phage tail tube protein | - |
| N4T36_RS14625 (N4T36_14625) | 2473075..2474223 | - | 1149 | WP_033841386.1 | hypothetical protein | - |
| N4T36_RS14630 (N4T36_14630) | 2474223..2474576 | - | 354 | WP_031975507.1 | hypothetical protein | - |
| N4T36_RS14635 (N4T36_14635) | 2474672..2474890 | - | 219 | WP_001277694.1 | hypothetical protein | - |
| N4T36_RS14640 (N4T36_14640) | 2474892..2475290 | - | 399 | WP_025466443.1 | phage tail terminator-like protein | - |
| N4T36_RS14645 (N4T36_14645) | 2475292..2475660 | - | 369 | WP_025466445.1 | hypothetical protein | - |
| N4T36_RS14650 (N4T36_14650) | 2475632..2476039 | - | 408 | WP_000255076.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2452377..2504149 | 51772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6685.80 Da Isoelectric Point: 10.5523
>T257700 WP_002108505.1 NZ_CP104347:c2471194-2471012 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257700 WP_000966688.1 NZ_CP104347:c2470919-2470515 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4SYJ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9L2H6 |