Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 893097..893776 | Replicon | chromosome |
| Accession | NZ_CP104347 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01332 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | N4T36_RS06715 | Protein ID | WP_000838146.1 |
| Coordinates | 893097..893279 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N4T36_RS06720 | Protein ID | WP_000966688.1 |
| Coordinates | 893372..893776 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T36_RS06675 (N4T36_06675) | 888271..888441 | + | 171 | WP_000220307.1 | hypothetical protein | - |
| N4T36_RS06680 (N4T36_06680) | 888452..888859 | + | 408 | WP_000255076.1 | hypothetical protein | - |
| N4T36_RS06685 (N4T36_06685) | 888831..889199 | + | 369 | WP_063558585.1 | hypothetical protein | - |
| N4T36_RS06690 (N4T36_06690) | 889201..889599 | + | 399 | WP_001251844.1 | phage tail terminator-like protein | - |
| N4T36_RS06695 (N4T36_06695) | 889668..890021 | + | 354 | WP_063558502.1 | hypothetical protein | - |
| N4T36_RS06700 (N4T36_06700) | 890021..891172 | + | 1152 | WP_063558501.1 | hypothetical protein | - |
| N4T36_RS06705 (N4T36_06705) | 891269..892186 | + | 918 | WP_075149897.1 | phage tail tube protein | - |
| N4T36_RS06710 (N4T36_06710) | 892256..892771 | + | 516 | WP_001185602.1 | hypothetical protein | - |
| N4T36_RS06715 (N4T36_06715) | 893097..893279 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4T36_RS06720 (N4T36_06720) | 893372..893776 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4T36_RS06725 (N4T36_06725) | 893875..894051 | + | 177 | WP_075149899.1 | hypothetical protein | - |
| N4T36_RS06730 (N4T36_06730) | 894060..894383 | + | 324 | WP_000523928.1 | DUF4236 domain-containing protein | - |
| N4T36_RS06735 (N4T36_06735) | 894416..895099 | + | 684 | WP_000720504.1 | hypothetical protein | - |
| N4T36_RS06740 (N4T36_06740) | 895171..895497 | + | 327 | WP_000721696.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 861295..921866 | 60571 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T257699 WP_000838146.1 NZ_CP104347:893097-893279 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257699 WP_000966688.1 NZ_CP104347:893372-893776 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|