Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 115866..116519 | Replicon | chromosome |
Accession | NZ_CP104347 | ||
Organism | Acinetobacter baumannii strain 2021CK-01332 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A427QZH0 |
Locus tag | N4T36_RS02660 | Protein ID | WP_000931891.1 |
Coordinates | 116130..116519 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | N4T36_RS02655 | Protein ID | WP_001288210.1 |
Coordinates | 115866..116123 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T36_RS02635 (N4T36_02635) | 111381..112388 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
N4T36_RS02640 (N4T36_02640) | 112407..112784 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
N4T36_RS02645 (N4T36_02645) | 112966..114456 | + | 1491 | WP_000415132.1 | NAD(P)/FAD-dependent oxidoreductase | - |
N4T36_RS02650 (N4T36_02650) | 114506..115678 | - | 1173 | WP_001190558.1 | acyl-CoA dehydrogenase family protein | - |
N4T36_RS02655 (N4T36_02655) | 115866..116123 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
N4T36_RS02660 (N4T36_02660) | 116130..116519 | + | 390 | WP_000931891.1 | hypothetical protein | Toxin |
N4T36_RS02665 (N4T36_02665) | 117289..118374 | + | 1086 | WP_000049104.1 | hypothetical protein | - |
N4T36_RS02670 (N4T36_02670) | 118452..119018 | + | 567 | WP_000651536.1 | rhombosortase | - |
N4T36_RS02675 (N4T36_02675) | 119206..121401 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15635.91 Da Isoelectric Point: 10.3890
>T257698 WP_000931891.1 NZ_CP104347:116130-116519 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A427QZH0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BQM7 |