Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 148427..149011 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP104345 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01332 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | N8Q7V3 |
| Locus tag | N4T36_RS00605 | Protein ID | WP_000286964.1 |
| Coordinates | 148427..148729 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N4T36_RS00610 | Protein ID | WP_000985609.1 |
| Coordinates | 148730..149011 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T36_RS00570 (N4T36_00570) | 143472..144086 | + | 615 | WP_125281634.1 | recombinase family protein | - |
| N4T36_RS00575 (N4T36_00575) | 144152..144955 | + | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| N4T36_RS00580 (N4T36_00580) | 144955..145791 | + | 837 | WP_040110386.1 | APH(6)-I family aminoglycoside O-phosphotransferase | - |
| N4T36_RS00585 (N4T36_00585) | 145981..146268 | + | 288 | WP_000438825.1 | BrnT family toxin | - |
| N4T36_RS00590 (N4T36_00590) | 146255..146569 | + | 315 | WP_004728120.1 | BrnA antitoxin family protein | - |
| N4T36_RS00595 (N4T36_00595) | 146736..147179 | - | 444 | WP_260744098.1 | hypothetical protein | - |
| N4T36_RS00600 (N4T36_00600) | 147257..148225 | + | 969 | WP_252513945.1 | IS30 family transposase | - |
| N4T36_RS00605 (N4T36_00605) | 148427..148729 | + | 303 | WP_000286964.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4T36_RS00610 (N4T36_00610) | 148730..149011 | + | 282 | WP_000985609.1 | putative addiction module antidote protein | Antitoxin |
| N4T36_RS00615 (N4T36_00615) | 149091..149510 | - | 420 | WP_001180106.1 | SMI1/KNR4 family protein | - |
| N4T36_RS00620 (N4T36_00620) | 149650..149970 | + | 321 | WP_000897307.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N4T36_RS00625 (N4T36_00625) | 149963..150235 | + | 273 | WP_000369781.1 | NadS family protein | - |
| N4T36_RS00630 (N4T36_00630) | 150728..152203 | + | 1476 | WP_000052512.1 | ABC-F type ribosomal protection protein Msr(E) | - |
| N4T36_RS00635 (N4T36_00635) | 152259..153143 | + | 885 | WP_000155092.1 | Mph(E) family macrolide 2'-phosphotransferase | - |
| N4T36_RS00640 (N4T36_00640) | 153333..153944 | - | 612 | WP_015060246.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(X3) / sul2 / aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) / ARR-3 / qacE / sul1 / blaNDM-1 / aph(3')-VI / blaOXA-58 | - | 1..338291 | 338291 | |
| - | inside | IScluster/Tn | aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) | - | 135314..153143 | 17829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11573.07 Da Isoelectric Point: 4.6838
>T257696 WP_000286964.1 NZ_CP104345:148427-148729 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|