Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 148427..149011 Replicon plasmid unnamed2
Accession NZ_CP104345
Organism Acinetobacter baumannii strain 2021CK-01332

Toxin (Protein)


Gene name PumA Uniprot ID N8Q7V3
Locus tag N4T36_RS00605 Protein ID WP_000286964.1
Coordinates 148427..148729 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag N4T36_RS00610 Protein ID WP_000985609.1
Coordinates 148730..149011 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T36_RS00570 (N4T36_00570) 143472..144086 + 615 WP_125281634.1 recombinase family protein -
N4T36_RS00575 (N4T36_00575) 144152..144955 + 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
N4T36_RS00580 (N4T36_00580) 144955..145791 + 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -
N4T36_RS00585 (N4T36_00585) 145981..146268 + 288 WP_000438825.1 BrnT family toxin -
N4T36_RS00590 (N4T36_00590) 146255..146569 + 315 WP_004728120.1 BrnA antitoxin family protein -
N4T36_RS00595 (N4T36_00595) 146736..147179 - 444 WP_260744098.1 hypothetical protein -
N4T36_RS00600 (N4T36_00600) 147257..148225 + 969 WP_252513945.1 IS30 family transposase -
N4T36_RS00605 (N4T36_00605) 148427..148729 + 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N4T36_RS00610 (N4T36_00610) 148730..149011 + 282 WP_000985609.1 putative addiction module antidote protein Antitoxin
N4T36_RS00615 (N4T36_00615) 149091..149510 - 420 WP_001180106.1 SMI1/KNR4 family protein -
N4T36_RS00620 (N4T36_00620) 149650..149970 + 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4T36_RS00625 (N4T36_00625) 149963..150235 + 273 WP_000369781.1 NadS family protein -
N4T36_RS00630 (N4T36_00630) 150728..152203 + 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
N4T36_RS00635 (N4T36_00635) 152259..153143 + 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
N4T36_RS00640 (N4T36_00640) 153333..153944 - 612 WP_015060246.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(X3) / sul2 / aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) / ARR-3 / qacE / sul1 / blaNDM-1 / aph(3')-VI / blaOXA-58 - 1..338291 338291
- inside IScluster/Tn aph(3'')-Ib / aph(6)-Id / msr(E) / mph(E) - 135314..153143 17829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-90)

Antitoxin

Uncharacterized protein HI1420

(4-91)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11573.07 Da        Isoelectric Point: 4.6838

>T257696 WP_000286964.1 NZ_CP104345:148427-148729 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL

Download         Length: 303 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10109.67 Da        Isoelectric Point: 8.0018

>AT257696 WP_000985609.1 NZ_CP104345:148730-149011 [Acinetobacter baumannii]
MAIKLRKWDSAEHLKTEDDMQAYLQACIEESNGDAAFIAKALGNIAKAKGMAQLSRDTGLGRESLYKALSGDVNPSFDTV
IKVVKALNLRLAI

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TV94

Antitoxin

Source ID Structure

References