Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 201162..201746 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104343 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01300 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | N8Q7V3 |
| Locus tag | N4T35_RS21230 | Protein ID | WP_000286964.1 |
| Coordinates | 201444..201746 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N4T35_RS21225 | Protein ID | WP_000985609.1 |
| Coordinates | 201162..201443 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T35_RS21195 (N4T35_21195) | 196229..196840 | + | 612 | WP_015060246.1 | recombinase family protein | - |
| N4T35_RS21200 (N4T35_21200) | 197030..197914 | - | 885 | WP_000155092.1 | Mph(E) family macrolide 2'-phosphotransferase | - |
| N4T35_RS21205 (N4T35_21205) | 197970..199445 | - | 1476 | WP_000052512.1 | ABC-F type ribosomal protection protein Msr(E) | - |
| N4T35_RS21210 (N4T35_21210) | 199938..200210 | - | 273 | WP_000369781.1 | NadS family protein | - |
| N4T35_RS21215 (N4T35_21215) | 200203..200523 | - | 321 | WP_000897307.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N4T35_RS21220 (N4T35_21220) | 200663..201082 | + | 420 | WP_001180106.1 | SMI1/KNR4 family protein | - |
| N4T35_RS21225 (N4T35_21225) | 201162..201443 | - | 282 | WP_000985609.1 | putative addiction module antidote protein | Antitoxin |
| N4T35_RS21230 (N4T35_21230) | 201444..201746 | - | 303 | WP_000286964.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4T35_RS21235 (N4T35_21235) | 201948..202916 | - | 969 | WP_260785412.1 | IS30 family transposase | - |
| N4T35_RS21240 (N4T35_21240) | 202994..203437 | + | 444 | WP_260744098.1 | hypothetical protein | - |
| N4T35_RS21245 (N4T35_21245) | 203604..203918 | - | 315 | WP_004728120.1 | BrnA antitoxin family protein | - |
| N4T35_RS21250 (N4T35_21250) | 203905..204192 | - | 288 | WP_000438825.1 | BrnT family toxin | - |
| N4T35_RS21255 (N4T35_21255) | 204382..205218 | - | 837 | WP_040110386.1 | APH(6)-I family aminoglycoside O-phosphotransferase | - |
| N4T35_RS21260 (N4T35_21260) | 205218..206021 | - | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| N4T35_RS21265 (N4T35_21265) | 206087..206701 | - | 615 | WP_125281634.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaOXA-58 / aph(3')-VI / blaNDM-1 / sul1 / qacE / ARR-3 / mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib / sul2 / tet(X3) | - | 1..335718 | 335718 | |
| - | inside | IScluster/Tn | mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib | - | 197030..214859 | 17829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11573.07 Da Isoelectric Point: 4.6838
>T257693 WP_000286964.1 NZ_CP104343:c201746-201444 [Acinetobacter baumannii]
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
MYSIYTTEVFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|