Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3329992..3330645 | Replicon | chromosome |
| Accession | NZ_CP104340 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01409 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A427QZH0 |
| Locus tag | N4T41_RS17825 | Protein ID | WP_000931891.1 |
| Coordinates | 3330256..3330645 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | N4T41_RS17820 | Protein ID | WP_001288210.1 |
| Coordinates | 3329992..3330249 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T41_RS17800 (N4T41_17810) | 3325506..3326513 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| N4T41_RS17805 (N4T41_17815) | 3326532..3326909 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| N4T41_RS17810 (N4T41_17820) | 3327092..3328582 | + | 1491 | WP_000415132.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| N4T41_RS17815 (N4T41_17825) | 3328632..3329804 | - | 1173 | WP_001190558.1 | acyl-CoA dehydrogenase family protein | - |
| N4T41_RS17820 (N4T41_17830) | 3329992..3330249 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| N4T41_RS17825 (N4T41_17835) | 3330256..3330645 | + | 390 | WP_000931891.1 | hypothetical protein | Toxin |
| N4T41_RS17830 (N4T41_17840) | 3331415..3332500 | + | 1086 | WP_000049104.1 | hypothetical protein | - |
| N4T41_RS17835 (N4T41_17845) | 3332578..3333144 | + | 567 | WP_000651536.1 | rhombosortase | - |
| N4T41_RS17840 (N4T41_17850) | 3333332..3335527 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15635.91 Da Isoelectric Point: 10.3890
>T257688 WP_000931891.1 NZ_CP104340:3330256-3330645 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A427QZH0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BQM7 |