Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1590075..1590754 | Replicon | chromosome |
| Accession | NZ_CP104340 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01409 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2S4SYJ5 |
| Locus tag | N4T41_RS09575 | Protein ID | WP_002108505.1 |
| Coordinates | 1590572..1590754 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N4T41_RS09570 | Protein ID | WP_000966688.1 |
| Coordinates | 1590075..1590479 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T41_RS09550 (N4T41_09560) | 1588243..1588989 | - | 747 | WP_000599536.1 | hypothetical protein | - |
| N4T41_RS09555 (N4T41_09565) | 1589051..1589434 | - | 384 | WP_000725050.1 | hypothetical protein | - |
| N4T41_RS09560 (N4T41_09570) | 1589467..1589790 | - | 324 | WP_000523928.1 | DUF4236 domain-containing protein | - |
| N4T41_RS09565 (N4T41_09575) | 1589803..1589976 | - | 174 | WP_260783948.1 | hypothetical protein | - |
| N4T41_RS09570 (N4T41_09580) | 1590075..1590479 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4T41_RS09575 (N4T41_09585) | 1590572..1590754 | - | 183 | WP_002108505.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4T41_RS09580 (N4T41_09590) | 1591080..1591595 | - | 516 | WP_001185610.1 | hypothetical protein | - |
| N4T41_RS09585 (N4T41_09595) | 1591665..1592582 | - | 918 | WP_000094249.1 | phage tail tube protein | - |
| N4T41_RS09590 (N4T41_09600) | 1592635..1593783 | - | 1149 | WP_033841386.1 | hypothetical protein | - |
| N4T41_RS09595 (N4T41_09605) | 1593783..1594136 | - | 354 | WP_031975507.1 | hypothetical protein | - |
| N4T41_RS09600 (N4T41_09610) | 1594232..1594450 | - | 219 | WP_001277694.1 | hypothetical protein | - |
| N4T41_RS09605 (N4T41_09615) | 1594452..1594850 | - | 399 | WP_025466443.1 | phage tail terminator-like protein | - |
| N4T41_RS09610 (N4T41_09620) | 1594852..1595220 | - | 369 | WP_025466445.1 | hypothetical protein | - |
| N4T41_RS09615 (N4T41_09625) | 1595192..1595599 | - | 408 | WP_000255076.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1574189..1623707 | 49518 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6685.80 Da Isoelectric Point: 10.5523
>T257687 WP_002108505.1 NZ_CP104340:c1590754-1590572 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTISHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257687 WP_000966688.1 NZ_CP104340:c1590479-1590075 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4SYJ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9L2H6 |