Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 15629..16308 | Replicon | chromosome |
| Accession | NZ_CP104340 | ||
| Organism | Acinetobacter baumannii strain 2021CK-01409 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | N4T41_RS01685 | Protein ID | WP_000838146.1 |
| Coordinates | 15629..15811 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | N4T41_RS01690 | Protein ID | WP_000966688.1 |
| Coordinates | 15904..16308 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T41_RS01645 (N4T41_01655) | 10803..10973 | + | 171 | WP_000220307.1 | hypothetical protein | - |
| N4T41_RS01650 (N4T41_01660) | 10984..11391 | + | 408 | WP_000255076.1 | hypothetical protein | - |
| N4T41_RS01655 (N4T41_01665) | 11363..11731 | + | 369 | WP_063558585.1 | hypothetical protein | - |
| N4T41_RS01660 (N4T41_01670) | 11733..12131 | + | 399 | WP_001251844.1 | phage tail terminator-like protein | - |
| N4T41_RS01665 (N4T41_01675) | 12200..12553 | + | 354 | WP_063558502.1 | hypothetical protein | - |
| N4T41_RS01670 (N4T41_01680) | 12553..13704 | + | 1152 | WP_063558501.1 | hypothetical protein | - |
| N4T41_RS01675 (N4T41_01685) | 13801..14718 | + | 918 | WP_075149897.1 | phage tail tube protein | - |
| N4T41_RS01680 (N4T41_01690) | 14788..15303 | + | 516 | WP_001185602.1 | hypothetical protein | - |
| N4T41_RS01685 (N4T41_01695) | 15629..15811 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N4T41_RS01690 (N4T41_01700) | 15904..16308 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N4T41_RS01695 (N4T41_01705) | 16407..16583 | + | 177 | WP_075149899.1 | hypothetical protein | - |
| N4T41_RS01700 (N4T41_01710) | 16592..16915 | + | 324 | WP_000523928.1 | DUF4236 domain-containing protein | - |
| N4T41_RS01705 (N4T41_01715) | 16948..17631 | + | 684 | WP_000720504.1 | hypothetical protein | - |
| N4T41_RS01710 (N4T41_01720) | 17703..18029 | + | 327 | WP_000721696.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1527..34911 | 33384 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T257686 WP_000838146.1 NZ_CP104340:15629-15811 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT257686 WP_000966688.1 NZ_CP104340:15904-16308 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|