Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 52570..53158 | Replicon | plasmid unnamed2 |
Accession | NZ_CP104339 | ||
Organism | Acinetobacter baumannii strain 2021CK-01409 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | N8SM64 |
Locus tag | N4T41_RS00360 | Protein ID | WP_000438825.1 |
Coordinates | 52871..53158 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | D3JXQ4 |
Locus tag | N4T41_RS00355 | Protein ID | WP_004728120.1 |
Coordinates | 52570..52884 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T41_RS00320 (N4T41_00320) | 48904..49176 | - | 273 | WP_000369781.1 | NadS family protein | - |
N4T41_RS00325 (N4T41_00325) | 49169..49489 | - | 321 | WP_000897307.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N4T41_RS00330 (N4T41_00330) | 49629..50048 | + | 420 | WP_001180106.1 | SMI1/KNR4 family protein | - |
N4T41_RS00335 (N4T41_00335) | 50128..50409 | - | 282 | WP_000985609.1 | putative addiction module antidote protein | - |
N4T41_RS00340 (N4T41_00340) | 50410..50712 | - | 303 | WP_000286964.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N4T41_RS00345 (N4T41_00345) | 50914..51882 | - | 969 | WP_252513945.1 | IS30 family transposase | - |
N4T41_RS00350 (N4T41_00350) | 51960..52403 | + | 444 | WP_260744098.1 | hypothetical protein | - |
N4T41_RS00355 (N4T41_00355) | 52570..52884 | - | 315 | WP_004728120.1 | BrnA antitoxin family protein | Antitoxin |
N4T41_RS00360 (N4T41_00360) | 52871..53158 | - | 288 | WP_000438825.1 | BrnT family toxin | Toxin |
N4T41_RS00365 (N4T41_00365) | 53348..54184 | - | 837 | WP_040110386.1 | APH(6)-I family aminoglycoside O-phosphotransferase | - |
N4T41_RS00370 (N4T41_00370) | 54184..54987 | - | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
N4T41_RS00375 (N4T41_00375) | 55053..55667 | - | 615 | WP_125281634.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaNDM-1 / sul1 / qacE / ARR-3 / mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib / sul2 / tet(X3) / blaOXA-58 | - | 1..329791 | 329791 | |
- | inside | IScluster/Tn | mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib | - | 45996..63825 | 17829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11304.70 Da Isoelectric Point: 5.6205
>T257685 WP_000438825.1 NZ_CP104339:c53158-52871 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A8TVQ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A8TRI9 |