257682

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) BrnTA/BrnT-BrnA
Location 293289..293877 Replicon plasmid unnamed4
Accession NZ_CP104336
Organism Acinetobacter baumannii strain 2021CK-01408

Toxin (Protein)


Gene name brnT Uniprot ID N8SM64
Locus tag N4T40_RS21640 Protein ID WP_000438825.1
Coordinates 293590..293877 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name brnA Uniprot ID D3JXQ4
Locus tag N4T40_RS21635 Protein ID WP_004728120.1
Coordinates 293289..293603 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T40_RS21600 (N4T40_21600) 289623..289895 - 273 WP_000369781.1 NadS family protein -
N4T40_RS21605 (N4T40_21605) 289888..290208 - 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4T40_RS21610 (N4T40_21610) 290348..290767 + 420 WP_001180106.1 SMI1/KNR4 family protein -
N4T40_RS21615 (N4T40_21615) 290847..291128 - 282 WP_000985609.1 putative addiction module antidote protein -
N4T40_RS21620 (N4T40_21620) 291129..291431 - 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
N4T40_RS21625 (N4T40_21625) 291633..292601 - 969 WP_252513945.1 IS30 family transposase -
N4T40_RS21630 (N4T40_21630) 292679..293122 + 444 WP_260744098.1 hypothetical protein -
N4T40_RS21635 (N4T40_21635) 293289..293603 - 315 WP_004728120.1 BrnA antitoxin family protein Antitoxin
N4T40_RS21640 (N4T40_21640) 293590..293877 - 288 WP_000438825.1 BrnT family toxin Toxin
N4T40_RS21645 (N4T40_21645) 294067..294903 - 837 WP_040110386.1 APH(6)-I family aminoglycoside O-phosphotransferase -
N4T40_RS21650 (N4T40_21650) 294903..295706 - 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
N4T40_RS21655 (N4T40_21655) 295772..296386 - 615 WP_125281634.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul2 / tet(X3) / blaOXA-58 / aph(3')-VI / blaNDM-1 / sul1 / qacE / ARR-3 / mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib - 1..328511 328511
- inside IScluster/Tn mph(E) / msr(E) / aph(6)-Id / aph(3'')-Ib - 286715..304544 17829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(7-88)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(41-96)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11304.70 Da        Isoelectric Point: 5.6205

>T257682 WP_000438825.1 NZ_CP104336:c293877-293590 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG

Download         Length: 288 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12200.86 Da        Isoelectric Point: 8.4628

>AT257682 WP_004728120.1 NZ_CP104336:c293603-293289 [Acinetobacter baumannii]
MSMVRYSRKELNEKFGEKQDAEIQRLLAKGTVPDDQLDLSDIPEITDWSSAVRQNQFYRPVKQQTSIRLDADVLAWFKAQ
GKGYQTRMNEILRDAMLKELKNHQ

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TVQ4

Antitoxin

Source ID Structure
AlphaFold DB A0A0A8TRI9

References